KEGG   Escherichia coli O104 H4 2011C-3493 (EAEC): O3K_20405
Entry
O3K_20405         CDS       T02257                                 

Definition
(RefSeq) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
esl  Escherichia coli O104:H4 2011C-3493 (EAEC)
Pathway
esl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:esl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    O3K_20405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:esl02044]
    O3K_20405
Secretion system [BR:esl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3K_20405
SSDB
Motif
Pfam: T6SS_HCP SBBP
Other DBs
NCBI-GeneID: 13703320
NCBI-ProteinID: YP_006780745
UniProt: A0A0E0Y4V8
Position
complement(4188902..4189420)
AA seq 172 aa
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPA
GQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTI
VDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaacaccgtgttatatctccatcactggtcagacccagggaaatattactgcaggt
gcatttaccgctgattctgtcggcaacatctatgtgcaggggcacgaagacgagatgctg
gtgcaggaattcctgcataacgttactgtcccgaccgatcctcagtccggtcagcctgcg
ggtcagcgtgctcacaagcctttcatttttaccgtggcgctgaacaaagcggttccgctg
atgtacaacgcactggcctccggcgaaatgctgccaaccactgaacttcactggtggcgt
acctctgtggaaggcaaacaggagcattatttcactacccgcctgactgattcgacgatt
gtcgatatgaaactgcatatgccgcattgccaggacccggcgaaacgcgagttcacccag
ttgctcgaagtttcactggcctaccgcaaaattgaatgggaacacgtcaaatctggcacc
tccggtgccgacgactggcgcgcaccgctggaagcataa

DBGET integrated database retrieval system