KEGG   Escherichia coli O104 H4 2011C-3493 (EAEC): O3K_20790Help
Entry
O3K_20790         CDS       T02257                                 

Definition
(RefSeq) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
esl  Escherichia coli O104:H4 2011C-3493 (EAEC)
Pathway
esl00860  Porphyrin and chlorophyll metabolism
esl01100  Metabolic pathways
esl01110  Biosynthesis of secondary metabolites
esl01120  Microbial metabolism in diverse environments
Module
esl_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
esl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    O3K_20790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:esl01007]
    O3K_20790
Enzymes [BR:esl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     O3K_20790
Amino acid related enzymes [BR:esl01007]
 Aminotransferase (transaminase)
  Class III
   O3K_20790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 13703404
NCBI-ProteinID: YP_006780822
UniProt: A0A0E0Y797
Position
4275686..4276966
Genome map
AA seq 426 aa AA seqDB search
MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWG
PMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVPTMDMVRMVNSGTEATM
SAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCT
YNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQDYYGVEPDLTCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSG
NPIAMAAGFACLNEVAQPGVHETLDELTSRLAEGLLEAAEEAGIPLVVNHVGGMFGIFFT
DAESVTCYQDVMACDVERFKRFFHMMLDEGVYLAPSAFEAGFMSVAHSMEDINNTIDAAR
RVFAKL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtctgaaaatctttacagcgcagcgcgcgagctgatccctggcggtgtgaac
tcccctgttcgcgcctttactggcgtgggcggcactccactgtttatcgaaaaagcggac
ggcgcctatctgtacgatgttgatggcaaagcctatatcgattatgtcggttcctggggg
ccgatggtgctgggccataaccatccggcgatccgcaatgccgtgattgaagccgccgag
cgtggtttaagctttggtgcaccaaccgaaatggaagtgaaaatggcgcaactggtgacc
gaactggtcccgaccatggatatggtgcgcatggtgaactccggcactgaagcgaccatg
agcgccatccgcctggcccgtggttttaccggtcgcgacaaaatcattaaatttgaaggt
tgttaccacggtcacgctgactgcctgctggtgaaagccggttctggcgcactcacgtta
ggccagccaaactcgccgggtgttccggcagatttcgccaaacataccttaacctgtact
tataacgatctggcttctgtacgcgccgcgtttgagcaatacccgcaagagattgcctgt
attatcgtcgagccggtggcaggcaatatgaactgcgttccaccgctgccagagttcctg
ccaggtctgcgcgcgctgtgcgacgaatttggcgcattgctgatcatcgatgaagtaatg
actggcttccgcgtagcgctagctggcgcacaggattattacggtgtggaaccggatctc
acctgcctgggcaaaatcatcggcggtggaatgccggtaggcgcattcggtggtcgtcgt
gatgtaatggatgcgctggccccgacgggtccggtctatcaggcgggtacgctttccggt
aacccaattgcgatggcagcgggtttcgcctgtctgaatgaagtcgcgcaaccgggcgtt
cacgaaacgttggatgagctgacatcacgtctggcagaaggtctgctggaagcggcagaa
gaagccggaattccgctggtcgttaaccacgttggcggcatgttcggtattttctttacc
gacgccgagtccgtgacgtgctatcaggatgtgatggcctgtgacgtggaacgctttaag
cgtttcttccatatgatgctggatgaaggtgtttacctggcaccgtcagcgtttgaagcg
ggctttatgtccgtggcgcacagcatggaagatatcaataacaccatcgatgctgcacgt
cgggtgtttgcgaagttgtga

DBGET integrated database retrieval system