KEGG   Escherichia coli O104 H4 2011C-3493 (EAEC): O3K_23985Help
Entry
O3K_23985         CDS       T02257                                 

Definition
(RefSeq) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
esl  Escherichia coli O104:H4 2011C-3493 (EAEC)
Pathway
esl00471  D-Glutamine and D-glutamate metabolism
esl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    O3K_23985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:esl01011]
    O3K_23985
Enzymes [BR:esl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     O3K_23985
Peptidoglycan biosynthesis and degradation proteins [BR:esl01011]
 Precursor biosynthesis
  Racemase
   O3K_23985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF1847
Motif
Other DBs
NCBI-GeneID: 13700067
NCBI-ProteinID: YP_006781445
UniProt: A0A0E0Y5G3
Structure
PDB: 

Position
complement(4975644..4976501)
Genome map
AA seq 285 aa AA seqDB search
MATKLQDGNTPCLAATPSEPRPTVLVFDSGVGGLSVYDEIRHLLPDLHYIYAFDNVAFPY
GEKSEEFIVERVVAIVTAVQERYPLALAVVACNTASTVSLPALREKFDFPVVGVVPAIKP
AARLTANGIVGLLATRGTVKRSYTHELIARFANECQIEMLGSAEMVELAEAKLHGEDVSL
DALKRILRPWLRMKEPPDTVVLGCTHFPLLQEELLQVLPEGTRLVDSGAAIARRTAWLLE
HEAPDAKSADANIAFCMAMTPEAEQLLPVLQRYGFETLEKLAVLG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaaactgcaggacgggaatacaccttgtctggcagctacaccttctgaacca
cgtcccaccgtgctggtgtttgactccggcgtcggtgggttgtcggtctatgacgagatc
cggcatctcttaccggatctccattacatttatgctttcgataacgtcgcttttccgtat
ggcgaaaaaagcgaagagtttattgttgagcgagtggtggcaattgtcaccgcagtgcaa
gaacgttatccccttgcgctggctgtggtcgcttgcaacaccgccagtaccgtttcactt
cctgcattacgcgaaaagttcgacttcccggttgttggtgtcgtgccggcgattaaacct
gctgcacgtctgacggcaaatggcattgtcggattactggcaacccgcggaactgttaaa
cgttcttatactcatgagctgatcgcgcgtttcgctaatgaatgccagatagaaatgctg
ggctcggcagagatggttgagttggctgaagcgaagctgcatggcgaagatgtttctctg
gatgcactaaaacgtatcctacgcccgtggttaagaatgaaagagccgccagataccgtt
gtattgggttgcacccatttccctctactacaagaagaactcttacaggtgctgccagag
ggaacccggctggtggattctggcgcagcgattgctcgcagaacggcctggctgttagaa
catgaagctccggatgcaaaatctgccgatgcgaatattgccttttgtatggcaatgacg
ccagaagctgaacaattattgcccgttttacagcgttacggcttcgaaacgctcgaaaaa
ctggcagttttaggctga

DBGET integrated database retrieval system