KEGG   Escherichia coli O104 H4 2009EL-2050 (EAEC): O3M_04415
Entry
O3M_04415         CDS       T02316                                 

Definition
(GenBank) hypothetical protein
Organism
esm  Escherichia coli O104:H4 2009EL-2050 (EAEC)
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AFS55598
Position
894784..895206
AA seq 140 aa
MHSFLQFLRDDNPGSLEDHLNFVPSDDLKYELGMLLSSRPLYLETDELPFVNSSVLNYGI
KSSVYVVSAGEHSDSVNDEISSRILMMLQRYESRLEEPVVEYLSSDDNYSFFSVTALFFM
DMVRLCIKWDKNSGEFSLDE
NT seq 423 nt   +upstreamnt  +downstreamnt
atgcattcgtttcttcagttcttacgtgatgataatccgggctctctggaagatcatctg
aattttgttccttcagatgatctgaaatatgagctcgggatgttattatcatcacgacct
ttataccttgaaacagatgagctgccgtttgttaatagttctgtcctgaactatggcata
aagtcatcagtatatgtagtttctgcaggtgaacatagtgattctgttaatgatgaaatt
tcttcaagaatattgatgatgctccagcgttatgagtcccggctggaggaaccagttgtt
gaatatctttccagtgatgataattattctttcttttcagttacagccctgttctttatg
gacatggtaagactctgtattaaatgggataagaactcaggagaattttcactggatgaa
taa

DBGET integrated database retrieval system