KEGG   Escherichia coli O104 H4 2009EL-2050 (EAEC): O3M_04445
Entry
O3M_04445         CDS       T02316                                 

Definition
(GenBank) hypothetical protein
Organism
esm  Escherichia coli O104:H4 2009EL-2050 (EAEC)
SSDB
Motif
Pfam: PAAR_motif DUF4150
Other DBs
NCBI-ProteinID: AFS55604
Position
900401..900706
AA seq 101 aa
MYMPQPAARVTDMHVCPMVTPGLPPVPHVGGPLLPPGSPSVFIGGLPAATLGTLALCSGP
VDVVIMGSVKVLICGKPAARMGDICAHGGTIVSGYPQVLIG
NT seq 306 nt   +upstreamnt  +downstreamnt
ttgtatatgcctcaacctgctgcaagagttactgatatgcatgtatgtcctatggtgacg
cctggtttaccacctgttccccatgttggggggccattgttaccaccaggctctccgtct
gtatttattggtggattaccggcagcgacattggggaccctggctctttgttctgggcca
gtggatgttgtcattatgggaagtgttaaggtcttgatatgcggcaaaccagctgcacga
atgggcgatatctgtgctcacggagggacaattgtcagtggatatcctcaggtattaata
ggatga

DBGET integrated database retrieval system