KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_08345Help
Entry
O3M_08345         CDS       T02316                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
esm00020  Citrate cycle (TCA cycle)
esm00620  Pyruvate metabolism
esm01100  Metabolic pathways
esm01110  Biosynthesis of secondary metabolites
esm01120  Microbial metabolism in diverse environments
esm01130  Biosynthesis of antibiotics
esm01200  Carbon metabolism
Module
esm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
esm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:esm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3M_08345
   00620 Pyruvate metabolism
    O3M_08345
Enzymes [BR:esm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     O3M_08345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 K_oxygenase FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFS56368
Position
1738235..1739881
Genome map
AA seq 548 aa AA seqDB search
MKKVTAMLFSMAVGLNAVSMAAKAKASEEQETDVLLIGGGIMSATLGTYLRELEPEWSMT
MVERLEGVAQESSNGWNNAGTGHSALMELNYTPQNADGSISIEKAVAINEAFQISRQFWA
HQVERGVLRTPRSFINTVPHMSFVWGEDNVNFLRARYAALQQSSLFRGMRYSEDHAQIKE
WAPLVMEGRDPQQKVAATRTEMGTDVNYGEITRQLIASLQKKSNFSLQLSSEVRALKRND
DNTWTVTVADLKNGTAQNIRAKFVFIGAGGAALKLLQESGIPEAKDYAGFPVGGQFLVSE
NPDVVNHHLAKVYGKASVGAPPMSVPHIDTRVLDGKRVVLFGPFATFSTKFLKNGSLWDL
MSSTTTSNVMPMMHVGLDNFDLVKYLVSQVMLSEEDRFEALKEYYPQAKKEDWRLWQAGQ
RVQIIKRDAEKGGVLRLGTEVVSDQQGTIAALLGASPGASTAAPIMLDLLEKVFGDRVSS
PQWQATLKAIVPSYGRKLNGDVAATERELQYTSEVLGLKYDKPQAADSTPKPQLKPQPVQ
KEVADIAL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgactgccatgctcttctcgatggccgtggggcttaatgccgtttcgatg
gcggcaaaagcgaaagcgtccgaggagcaggaaactgatgtactgttgattggcggcggc
attatgagcgccacgttggggacctatttacgcgagctggagcctgaatggtcgatgacc
atggtggagcgcctggagggtgtcgcgcaggagagttcgaacggctggaataacgccgga
accgggcattctgcactgatggaactgaactacaccccgcaaaacgccgatggcagcatc
agtattgaaaaagcagtcgccattaacgaagcatttcagatttcccgccagttctgggcg
caccaggttgagcgcggcgtgctgcgtactccgcgttcatttatcaataccgttccgcat
atgagctttgtctggggcgaggataacgttaatttcctgcgcgcccgttacgccgcgttg
caacaaagctcgctgtttcgcggtatgcgttactctgaagatcacgcgcagatcaaagag
tgggcaccgttagtgatggaagggcgcgatccacaacagaaagtagcggcaacacgcaca
gaaatgggcactgatgtgaactatggcgagatcacccgccagttaattgcttccttacag
aagaaatctaacttctcgctgcaactcagcagcgaagtccgcgccctaaagcgtaatgac
gataacacctggaccgttaccgttgccgatctgaaaaacggcactgcacagaacatccgc
gccaaatttgtctttatcggcgcgggcggtgcggcgctgaagctattacaggaatcgggg
attccggaagcgaaagactacgccggtttcccggtgggcggacagttccttgtttcggaa
aacccggacgtggttaatcaccatctggcgaaggtttacggtaaagcatccgttggcgca
ccaccgatgtcggttccgcatatcgatacccgcgttctggacggtaaacgcgtagtgctg
tttgggccatttgccaccttctcaaccaaattcctcaaaaacggttcattgtgggatctg
atgagttccaccaccacctctaacgtgatgccgatgatgcacgtcgggctggataatttc
gatctggtgaaatatctggtgagtcaggtgatgttgagtgaagaggatcgttttgaagcg
ttgaaagagtactatccgcaggcaaaaaaagaggactggcgtttgtggcaagcggggcag
cgcgtgcagattatcaagcgtgatgccgagaaaggtggcgtactgcgtctgggtactgaa
gtggtcagtgaccagcaagggaccattgccgcgctgctgggggcatcgccaggggcgtca
accgccgcgccgattatgttggatctgctggaaaaagtatttggcgatcgcgtttccagc
ccgcaatggcaggctacgttgaaagcgatcgttccgtcttatggacgcaagctgaacggt
gatgtagcggcaacagaacgcgagttgcagtacaccagcgaagtgctggggctgaaatac
gacaagccgcaggcagcagatagtacgccaaaaccgcagttgaaaccgcaacccgttcaa
aaagaagtggcggatattgcgttgtaa

DBGET integrated database retrieval system