KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_13070Help
Entry
O3M_13070         CDS       T02316                                 

Definition
(GenBank) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
esm00010  Glycolysis / Gluconeogenesis
esm00071  Fatty acid degradation
esm00350  Tyrosine metabolism
esm00625  Chloroalkane and chloroalkene degradation
esm00626  Naphthalene degradation
esm01100  Metabolic pathways
esm01110  Biosynthesis of secondary metabolites
esm01120  Microbial metabolism in diverse environments
esm01130  Biosynthesis of antibiotics
esm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:esm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3M_13070
  Lipid metabolism
   00071 Fatty acid degradation
    O3M_13070
  Amino acid metabolism
   00350 Tyrosine metabolism
    O3M_13070
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    O3M_13070
   00626 Naphthalene degradation
    O3M_13070
Enzymes [BR:esm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     O3M_13070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C Methyltransf_31 Phage_holin_2_1
Motif
Other DBs
NCBI-ProteinID: AFS57298
Structure
PDB: 

Position
2675146..2676156
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcacgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaactggcgtaattctgggccatgaaggc
atcggtgtggtggcagaagttggccctggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctacgaaggatgcggtcattgcgaatactgtaatagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaaactgtcaaaaattcgt
ccagggcagtggattgctatctacggtcttggcggtctgggtaacctcgctctgcaatac
gcgaagaatgtctttaacgcgaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggtgcagatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggcgctcacgctgcggtggtaacagcagttgctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcggtcgtgttgtggctgtcggtctg
ccgccggagtctatgagcctggatatcccacgccttgtgctggatggcattgaagtggtc
ggttcgctggtcggcacgcgccaggatctaaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgttaa

DBGET integrated database retrieval system