KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_13995Help
Entry
O3M_13995         CDS       T02316                                 

Definition
(GenBank) hypothetical protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Brite
KEGG Orthology (KO) [BR:esm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    O3M_13995
Enzymes [BR:esm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     O3M_13995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AFS57479
Position
complement(2874258..2875139)
Genome map
AA seq 293 aa AA seqDB search
MSDTNYAVIYDLHSHTTASDGCLTPEALVHRAVEMRVGTLAITDHDTTAAIAPAREEISR
SGLALNLIPGVEISTVWENHEIHIVGLNIDITHPLMCEFLAQQTERRNQRAQLIAERLEK
AQIPGALEGAQRLAQGGAVTRGHFARFLVECGKASSMADVFKKYLARGKTGYVPPQWCTI
EQAIDVIHHSGGKAVLAHPGRYNLSAKWLKRLVAHFAEHHGDAMEVAQCQQSPNERTQLA
ALARQHHLWASQGSDFHQPCPWIELGRKLWLPAGVEGVWQLWEQPQNTTEREL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgacacgaattatgcagtgatttacgacctgcacagccataccacagcttccgat
ggctgcctgacgccagaagcattggtgcaccgtgcagtcgagatgcgcgtcggcaccctg
gcgatcaccgaccatgacaccacagctgcaatcgcgccagcaagagaggaaatttcacgt
tcgggactggcgttgaatcttattcccggcgtggaaatttccacggtctgggaaaatcat
gaaattcatattgtcgggctgaatattgatattactcatccgctaatgtgtgagttcctc
gcgcagcagacagaacggcgcaatcagcgggcgcagctgattgccgaaagacttgaaaaa
gcgcaaatacctggggcgctggaaggcgcacaacgactggcgcagggcggcgcagtgacg
cgcggtcattttgcgcgtttccttgttgagtgcggcaaagccagttcaatggcggatgtc
tttaaaaagtatctggcgcgcgggaaaaccggatacgttccgccacagtggtgtacaata
gaacaagctattgatgtcattcatcattctggcggtaaggcggtgctagctcatcctggg
cggtacaatcttagtgctaaatggctgaaaagattggttgcgcattttgccgaacaccac
ggtgacgcgatggaagtcgcgcagtgccagcaatcgcccaatgaacgtacccagctggcg
gcccttgcgcgtcagcatcatttatgggcatcacaaggatctgattttcatcagccatgc
ccgtggatcgaactgggtcgtaaactctggctgcccgcaggcgttgaaggcgtctggcag
ctatgggaacagccgcagaacaccacagagagggaattatga

DBGET integrated database retrieval system