KEGG   Escherichia coli O104 H4 2009EL-2050 (EAEC): O3M_20320
Entry
O3M_20320         CDS       T02316                                 

Definition
(GenBank) hypothetical protein
Organism
esm  Escherichia coli O104:H4 2009EL-2050 (EAEC)
SSDB
Motif
Pfam: VipB
Other DBs
NCBI-ProteinID: AFS58725
Position
4168361..4168585
AA seq 74 aa
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFC
EFQQSASHWQRVLH
NT seq 225 nt   +upstreamnt  +downstreamnt
atgacggcacacaaaaatatctccgggacataccacctctctgttgcagacattctgcag
gtggtttaccaggtatgtttcagcccgtccgttgaaatcaaccaggatggtgtggctgcg
ctgattacaacactggatcgccgtatcagtgatctattggatgagattatccatttttgt
gagtttcagcagagcgcgtcgcactggcagcgcgtacttcactga

DBGET integrated database retrieval system