KEGG   Escherichia coli O104 H4 2009EL-2050 (EAEC): O3M_20325
Entry
O3M_20325         CDS       T02316                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
esm  Escherichia coli O104:H4 2009EL-2050 (EAEC)
Brite
KEGG Orthology (KO) [BR:esm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:esm02044]
    O3M_20325
Secretion system [BR:esm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3M_20325
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AFS58726
Position
4168636..4170111
AA seq 491 aa
MSLQEEELVSSHAGQPEQASSLLDQIMAQTRIQPGSEGYDVARQGVTAFIASILQSTASA
EPVNKLAVDSMIADIDERISRQMDVIIHAPAFQQVESFWRSLKTMVDRVDFRENIKVNVL
HVTKQELLEDFEFAPEIIQSGFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTAPDMKLLQY
VSAVGAMAHAPFLSSVSPEFMGLNSWTELPNIKDLYAIFEGPAYTKWRALRDSEDSRYLG
LTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNTAWMLACNIADSFAKYRWCPN
IIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITLTMRKDSDNAA
FFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEGEPGWYQVALSVRPHFKFMGANF
ELSLVGRLDRE
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtctttacaggaagaggaactcgtatccagtcatgccgggcagcctgagcaggcatcg
tcgctgcttgatcaaatcatggcacagacccgtattcagcccggttcggaaggttatgac
gttgcccgccagggtgtgacagcctttattgccagcatcctgcaatccactgcatctgcc
gaaccggtcaataaactggccgtggacagcatgattgcagatattgatgaacgcatcagc
cgccagatggatgtcatcatccatgcgcctgcctttcagcaggtcgagtcgttctggcgc
tcactgaaaaccatggtggatcgcgttgatttccgtgaaaacatcaaggtcaacgtgctt
catgtcaccaagcaggaacttctggaagactttgagtttgcgccagaaattattcagtcc
ggattttataagcacgtttattcgtccggtttcggacagtttggcggtgaacccatcgct
gccgtgctgggcgcttatgagttcaaaaataccgcgcctgacatgaaactgctgcaatac
gtcagtgccgtgggcgcaatggcgcacgcaccgttcctgtcctccgtttccccggagttt
atggggctgaactcgtggaccgaactgcctaatatcaaagatctttatgccatctttgaa
ggtccggcctacaccaaatggcgcgccctgcgtgactcggaagattcgcgctatttaggg
cttacggcaccccgcttcctgcttcgccagccctattcaccaacagataaccctgttaag
aactttaactattacgaagatgtcagccagaaccacgaagattatctgtggggtaatacg
gcctggatgctggcatgcaatatcgcagacagttttgccaaataccgctggtgtccaaac
attatcggtccgcaaagcggcggcgcagtgaaagatctgccggtgcatctgttcgaaacg
atggggcagattcaggccaaaatcccaaccgaggtgctggtcaccgatcgccgcgaattt
gaactggctgaagagggttttatcacccttaccatgcgtaaagactctgataatgcagcc
tttttctctgcaaactcggtacaaaaaccgaagcactttccgggaaaagatgcagaaacc
aactataagctgggtacgcagcttccttatctcttcatcatcaatcggttagcgcactac
atcaaggtgttgcagcgtgaacaactggggtcatggaaagaaaggagcgacttagaaaga
gagcttaatacctggatccgtcagtatgttgccgaccaggaaaacccgcctgcagacgtg
cgcagccgcaaacctctgcgcgctgccaaagttgaggttatggatgtagaaggcgaaccc
ggctggtaccaggttgcgctaagcgtgagacctcattttaaatttatgggggcaaatttt
gagctttccctggttggccggttagacagggagtaa

DBGET integrated database retrieval system