KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_01205Help
Entry
O3O_01205         CDS       T02256                                 

Definition
(GenBank) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00270  Cysteine and methionine metabolism
eso00450  Selenocompound metabolism
eso00920  Sulfur metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01130  Biosynthesis of antibiotics
eso01230  Biosynthesis of amino acids
Module
eso_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    O3O_01205
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    O3O_01205
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    O3O_01205
Enzymes [BR:eso01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     O3O_01205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AFS84032
Structure
PDB: 

Position
complement(5054463..5055623)
Genome map
AA seq 386 aa AA seqDB search
MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVL
FVDQGDEQALRAALAEKPKLVLVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPA
LQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYL
LLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAML
SFELDGDEQTLRRFLSGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLL
RISTGIEDGEDLIADLENGFRAANKG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtaaacaggccaccatcgcagtgcgtagcgggttaaatgacgacgaacagtat
ggttgcgttgtcccaccgatccatctttccagcacatataactttaccggatttaatgaa
ccgcgcgcgcatgattactcgcgtcgcggcaacccaacgcgcgatgtggttcagcgtgcg
ctggcagaactggaaggcggtgctggtgcagtacttactaataccggcatgtccgcgatt
cacctggtaacgaccgtctttttgaaacctggcgatctgctggttgcgccgcacgactgc
tacggcggtagctatcgcctgttcgacagcctggcgaaacgcggttgctatcgcgtgttg
tttgttgatcaaggcgatgaacaggcattacgggcagcgctggcagaaaaacccaaactg
gtactggtagaaagcccaagtaatccattgttacgcgtcgtggatattgcgaaaatctgc
catctggcaagggaagtcggggcggtgagcgtggtggataacaccttcttaagcccggca
ttacaaaatccgctggcattaggtgccgatctggtgttgcattcatgcacgaaatatctg
aacggtcactcagacgtggtggctggcgtggtgattgctaaagatccggacgttgtcacc
gaactggcctggtgggcaaacaatattggcgtgacgggcggcgcgtttgacagctatctg
ctgctacgcgggttgcgaactctggtgccgcgtatggagctggcgcagcgcaacgcgcag
gcgattgtgaaatatctgcaaacccagccgttggtgaaaaaactgtatcacccgtcgctg
ccggaaaatcaggggcatgaaattgccgcgcgtcagcaaaaaggctttggcgcaatgttg
agttttgaactggatggcgatgagcagacgctgcgtcgtttcctgagcgggctgtcgttg
tttacgctggcggaatcattagggggagtggaaagtttaatctctcacgccgcaaccatg
acacatgcaggcatggcaccagaagcgcgtgctgccgccgggatctccgagacgctgctg
cgtatctccaccggtattgaagatggcgaagatttaattgccgacctggaaaatggcttc
cgggctgcaaacaaggggtaa

DBGET integrated database retrieval system