KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_01605Help
Entry
O3O_01605         CDS       T02256                                 

Gene name
pgi
Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso00030  Pentose phosphate pathway
eso00500  Starch and sucrose metabolism
eso00520  Amino sugar and nucleotide sugar metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
Module
eso_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eso_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_01605 (pgi)
   00030 Pentose phosphate pathway
    O3O_01605 (pgi)
   00500 Starch and sucrose metabolism
    O3O_01605 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_01605 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eso04147]
    O3O_01605 (pgi)
Enzymes [BR:eso01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     O3O_01605 (pgi)
Exosome [BR:eso04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   O3O_01605 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   O3O_01605 (pgi)
  Exosomal proteins of colorectal cancer cells
   O3O_01605 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: AFS84111
Structure
PDB: 

Position
complement(4943939..4945588)
Genome map
AA seq 549 aa AA seqDB search
MKNINPTQTAAWQALQKHFDEMKDVTIADLFAKDGDRFSKFSATFDDQMLVDYSKNRITE
ETLAKLQDLAKECDLAGAIKSMFSGEKINRTENRAVLHVALRNRSNTPILVDGKDVMPEV
NAVLEKMKTFSEAIISGEWKGYTGKAITDVVNIGIGGSDLGPYMVTEALRPYKNHLNMHF
VSNVDGTHIAEVLKKVNPETTLFLVASKTFTTQETMTNAHSARDWFLKAAGDEKHVAKHF
AALSTNAKAVGEFGIDTANMFEFWDWVGGRYSLWSAIGLSIVLSIGFDNFVELLSGAHAM
DKHFSTTPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQYMHRFAAYFQQGNMESNGKY
VDRNGNVVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKMVPCDFIAPAITHNPLSDHHQKL
LSNFFAQTEALAFGKSREVVEQEYRDQGKDPATLDYVVPFKVFEGNRPTNSILLREITPF
SLGALIALYEHKIFTQGVILNIFTFDQWGVELGKQLANRILPELKDDKEISSHDSSTNGL
INRYKAWRG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatcaatccaacgcagaccgctgcctggcaggcactacagaaacacttcgat
gaaatgaaagacgttacgatcgccgatctttttgctaaagacggcgatcgtttttctaag
ttctccgcaaccttcgacgatcagatgctggtggattactccaaaaaccgcatcactgaa
gagacgctggcgaaattacaggatctggcgaaagagtgcgatctggcgggcgcgattaag
tcgatgttctctggcgagaagatcaaccgcactgaaaaccgcgccgtgctgcacgtagcg
ctgcgtaaccgtagcaataccccgattctggttgatggcaaagacgtaatgccggaagtc
aacgcggtgctggagaagatgaaaaccttctcggaagcgattatctccggtgagtggaag
ggttataccggcaaagcaatcactgacgtagtgaacatcgggatcggtggttctgacctc
ggcccgtacatggtgaccgaagcactgcgtccgtacaaaaatcacctgaacatgcacttt
gtttctaacgtcgatgggactcacatcgctgaagtgctgaaaaaagtaaacccggaaacc
acgctgttcctggtagcatctaaaaccttcaccactcaggaaactatgaccaacgcccat
agcgcgcgtgactggttcctgaaagcggcaggtgatgaaaaacacgttgcaaaacacttt
gcggcgctttccaccaatgccaaagccgttggcgagtttggtattgatactgccaacatg
ttcgagttctgggactgggtcggcggccgttactctttgtggtcagcgattggcctgtcg
attgttctctccatcggctttgataacttcgttgaactgctttctggcgcacacgcaatg
gacaagcatttctccaccacgcctgccgagaaaaacctgcctgtcctgctggcgctgatt
ggcatctggtacaacaatttctttggtgcggaaactgaagcgattctgccgtatgaccag
tatatgcaccgtttcgcggcgtacttccagcagggcaatatggagtccaacggtaagtat
gttgaccgtaacggtaacgttgtggattaccagactggcccgattatctggggtgaacca
ggcactaacggtcagcacgcgttctaccagctgatccaccagggaaccaaaatggtaccg
tgcgatttcatcgccccggctatcacccataacccgctctctgatcaccaccagaaactg
ctgtctaacttcttcgcccagaccgaagcgctggcgtttggtaaatcccgcgaagtggtt
gagcaggaatatcgcgatcagggtaaagatccggcaacgcttgactacgtggtgccgttc
aaagtgttcgaaggtaaccgcccgaccaactccatcctgctgcgcgaaatcactccgttc
agcctgggggcgttgattgcgctgtatgagcacaaaatctttactcagggcgtgatcctg
aacatcttcaccttcgaccagtggggcgtggagctgggtaaacaactggcaaaccgtatt
ctgccagagctgaaagatgataaagaaatcagcagccacgatagctcgaccaatggtctg
attaaccgctataaagcgtggcgcggttaa

DBGET integrated database retrieval system