KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_04590Help
Entry
O3O_04590         CDS       T02256                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00860  Porphyrin and chlorophyll metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
Module
eso_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
eso_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    O3O_04590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eso01007]
    O3O_04590
Enzymes [BR:eso01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     O3O_04590
Amino acid related enzymes [BR:eso01007]
 Aminotransferase (transaminase)
  Class III
   O3O_04590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFS84692
Position
4312366..4313646
Genome map
AA seq 426 aa AA seqDB search
MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWG
PMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVPTMDMVRMVNSGTEATM
SAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCT
YNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQDYYGVEPDLTCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSG
NPIAMAAGFACLNEVAQPGVHETLDELTSRLAEGLLEAAEEAGIPLVVNHVGGMFGIFFT
DAESVTCYQDVMACDVERFKRFFHMMLDEGVYLAPSAFEAGFMSVAHSMEDINNTIDAAR
RVFAKL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtctgaaaatctttacagcgcagcgcgcgagctgatccctggcggtgtgaac
tcccctgttcgcgcctttactggcgtgggcggcactccactgtttatcgaaaaagcggac
ggcgcctatctgtacgatgttgatggcaaagcctatatcgattatgtcggttcctggggg
ccgatggtgctgggccataaccatccggcgatccgcaatgccgtgattgaagccgccgag
cgtggtttaagctttggtgcaccaaccgaaatggaagtgaaaatggcgcaactggtgacc
gaactggtcccgaccatggatatggtgcgcatggtgaactccggcactgaagcgaccatg
agcgccatccgcctggcccgtggttttaccggtcgcgacaaaatcattaaatttgaaggt
tgttaccacggtcacgctgactgcctgctggtgaaagccggttctggcgcactcacgtta
ggccagccaaactcgccgggtgttccggcagatttcgccaaacataccttaacctgtact
tataacgatctggcttctgtacgcgccgcgtttgagcaatacccgcaagagattgcctgt
attatcgtcgagccggtggcaggcaatatgaactgcgttccaccgctgccagagttcctg
ccaggtctgcgcgcgctgtgcgacgaatttggcgcattgctgatcatcgatgaagtaatg
actggcttccgcgtagcgctagctggcgcacaggattattacggtgtggaaccggatctc
acctgcctgggcaaaatcatcggcggtggaatgccggtaggcgcattcggtggtcgtcgt
gatgtaatggatgcgctggccccgacgggtccggtctatcaggcgggtacgctttccggt
aacccaattgcgatggcagcgggtttcgcctgtctgaatgaagtcgcgcaaccgggcgtt
cacgaaacgttggatgagctgacatcacgtctggcagaaggtctgctggaagcggcagaa
gaagccggaattccgctggtcgttaaccacgttggcggcatgttcggtattttctttacc
gacgccgagtccgtgacgtgctatcaggatgtgatggcctgtgacgtggaacgctttaag
cgtttcttccatatgatgctggatgaaggtgtttacctggcaccgtcagcgtttgaagcg
ggctttatgtccgtggcgcacagcatggaagatatcaataacaccatcgatgctgcacgt
cgggtgtttgcgaagttgtga

DBGET integrated database retrieval system