KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_04965
Entry
O3O_04965         CDS       T02256                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Brite
KEGG Orthology (KO) [BR:eso00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eso02044]
    O3O_04965
Secretion system [BR:eso02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3O_04965
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFS84767
Position
4226798..4227298
AA seq 166 aa
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSPLDERQAVSVN
KHNFGAVMAEAAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLL
ELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGLVSNK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagcaaaaaatttgaaggcagcgtcgcgcctcgcgagcgtattaatatatcgtatgtc
ccaaaaacagatggccagacggctgaagtggaacttccgcttaacatgctcgttgtcggc
gataccggaaatacgcaggaaacatccccactggatgaacgtcaggcagtttccgttaac
aagcacaatttcggtgcagtgatggctgaagcagccattggcctcaattttactgtcccc
gccacgctgaagggaagcacaacagacgatgaactgaatgtggcgctgaatatcaaatca
ctggatgatttttcaccagatagcgtggcccggcaggttccggaagtgaataaattgctg
gaactgcgtgaagcactgactgcactgaaggggccgatgggtaaccttccggcattccgt
acccagctccaggcattgctggaaaatgaagagtcccgcgagcagttgctcaaagaaatc
ggtctggtgagcaataaataa

DBGET integrated database retrieval system