KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_05075Help
Entry
O3O_05075         CDS       T02256                                 

Definition
(GenBank) hypothetical protein
  KO
K02557  chemotaxis protein MotB
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02030  Bacterial chemotaxis
eso02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eso00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    O3O_05075
   02040 Flagellar assembly
    O3O_05075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eso02000]
    O3O_05075
   02035 Bacterial motility proteins [BR:eso02035]
    O3O_05075
Transporters [BR:eso02000]
 Other Transporters
  Pores ion channels [TC:1]
   O3O_05075
Bacterial motility proteins [BR:eso02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    O3O_05075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA SulA
Motif
Other DBs
NCBI-ProteinID: AFS84787
Position
complement(4205139..4205924)
Genome map
AA seq 261 aa AA seqDB search
MTTIKLIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHPPKPATVAVPEETEKK
ARDVNEKTVLLKKKSATELGELATSINTIARDAHMEANLEMEIVPQGLRVLIKDDQNRNM
FERGSAQIMPFFKRLLVELAPVFDSLDNKIIITGHTDAMAYKNNIYNNWNLSGDRALSAR
RVLEEAGMPEDKVMQVSAMADQMLLDAKNPQSAGNRRIEIMVLTKSASDTLYQYFGQHGD
KVVQPLVQKLDKQQVLSQRTR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgataaagttgattgtcaacagcgtcagtaaatccgagcgtgaaagcattatc
gccgcgctgcacgggcagtcgatttttaacggtggtgggctgtcgccgttaaataaaatc
agcccgtctcatccgccaaaacctgccaccgtggcggtgccggaagagacggagaaaaaa
gcgcgtgacgtcaatgagaaaacggtgctgctgaagaagaaatccgccaccgagcttggc
gagctggcaaccagtatcaacaccattgcccgtgatgcgcatatggaagcgaatctggag
atggagattgtcccgcagggattacgcgtgctgattaaagacgaccagaatcgcaatatg
ttcgaacgcggcagcgcgcagattatgccgttctttaaaaggctgctggtggagctcgcg
ccagttttcgactcgctcgataacaaaattattattaccgggcataccgatgcgatggcc
tacaaaaacaatatctacaacaactggaacctttcgggcgatcgcgcgctttcagctcgt
cgggtgctggaagaggccggaatgccggaagataaagtgatgcaggtaagcgcaatggcg
gaccagatgctgctggacgcgaaaaatccgcaaagcgcgggcaaccggcgcattgagatt
atggtgctgaccaaaagtgcgtccgatacgctgtatcaatactttggtcagcatggggat
aaagtggtgcagccgctggtgcaaaagctggataagcagcaggtgctttcacagcgaacg
cgctag

KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_15470Help
Entry
O3O_15470         CDS       T02256                                 

Gene name
motB
Definition
(GenBank) flagellar motor protein MotB
  KO
K02557  chemotaxis protein MotB
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02030  Bacterial chemotaxis
eso02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eso00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    O3O_15470 (motB)
   02040 Flagellar assembly
    O3O_15470 (motB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eso02000]
    O3O_15470 (motB)
   02035 Bacterial motility proteins [BR:eso02035]
    O3O_15470 (motB)
Transporters [BR:eso02000]
 Other Transporters
  Pores ion channels [TC:1]
   O3O_15470 (motB)
Bacterial motility proteins [BR:eso02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    O3O_15470 (motB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotB_plug OmpA
Motif
Other DBs
NCBI-ProteinID: AFS86841
Position
2119570..2120496
Genome map
AA seq 308 aa AA seqDB search
MKNQAHPIIVVKRRKAKSHGAAHGSWKIAYADFMTAMMAFFLVMWLISISSPKELIQIAE
YFRTPLATAVTGGDRISNSESPIPGGGDDYTQSQGEVNKQPNIEELKKRMEQSRLRKLRG
DLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFRTGSADVEPYMRDILRAIA
PVLNGIPNRISLSGHTDDFPYASGEKGYSNWELSADRANASRRELMVGGLDSGKVLRVVG
MAATMRLSDRGPDDAVNRRISLLVLNKQAEQAILHENAESQNEPVSALEKPEVAPQVSVP
TMPSAEPR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcaagcgcatccgattattgtcgtcaaacgacgcaaagccaaaagccacggg
gcagcacatggatcgtggaagattgcttatgccgactttatgactgcgatgatggccttt
tttctggtgatgtggctgatctccatctccagcccaaaagagctgattcagattgcggag
tacttccggactccactggcgactgcggttacgggcggcgatcgcatttctaatagtgaa
agcccaattcccggcggtggtgatgattacacccaaagccagggggaagtgaataagcag
ccgaacatcgaagagctgaaaaaacgcatggagcaaagtcgattgcggaaattgcggggt
gatctcgaccagttgatagagtccgatccgaaactgcgggcgttacgtccccatctcaaa
atcgatctggtccaggaaggtctacgtattcagatcatcgatagccagaatcgcccgatg
tttagaaccggcagtgccgatgtcgaaccctatatgcgcgacattctgcgcgccattgcg
cctgtactgaacggtattcccaaccgtattagcctttcaggtcataccgatgatttcccc
tacgccagcggtgagaaaggatatagcaactgggagctttctgccgatcgggccaatgca
tcccgccgcgaactgatggtcggagggttggatagcggcaaagtgttacgtgtcgtcggc
atggcggcaacgatgcgcttaagcgatcgcggacctgatgatgccgtcaaccgtcgcatc
agcctgctggtactgaacaaacaagccgaacaggccattttgcatgaaaacgccgaaagc
cagaatgagccagtaagcgccctggaaaaacctgaggttgcaccacaggtcagtgttccc
acaatgccatcagccgaaccgaggtga

DBGET integrated database retrieval system