KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_05600Help
Entry
O3O_05600         CDS       T02256                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso00071  Fatty acid degradation
eso00350  Tyrosine metabolism
eso00625  Chloroalkane and chloroalkene degradation
eso00626  Naphthalene degradation
eso00680  Methane metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
eso01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_05600
  09102 Energy metabolism
   00680 Methane metabolism
    O3O_05600
  09103 Lipid metabolism
   00071 Fatty acid degradation
    O3O_05600
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    O3O_05600
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    O3O_05600
   00626 Naphthalene degradation
    O3O_05600
Enzymes [BR:eso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     O3O_05600
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     O3O_05600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N MinC_C 2-Hacid_dh_C Met_10 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AFS84892
Position
4085818..4086927
Genome map
AA seq 369 aa AA seqDB search
MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEGVFPVVL
GHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETQGKGLMPD
GTTRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHN
TAKVQPGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPKKFDLARRFGATDCINPND
YDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAGSGQEISTRP
FQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVTHTMSLDEINDAFDLMHEG
KSIRTVIRY
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgtgctgccgttgcatttgctcccggtaaaccgctggaaatcgttgaaatt
gacgttgcaccaccgaaaaaaggtgaagtgctgattaaagtcacccataccggcgtttgc
cataccgacgcatttaccctctccggggatgacccggaaggtgtattcccggtggttctc
ggtcacgaaggggccggcgttgtggttgaagtcggtgaaggcgtaaccagcgtcaaacct
ggcgaccatgtgatcccgctttacaccgcggagtgcggcgagtgtgagttctgtcgttct
ggcaaaactaacctctgtgttgcggttcgcgaaacccagggtaaaggcttgatgccagac
ggcaccacccgtttttcttacaacgggcagccgctttatcactacatggggtgctctaca
ttcagtgaatacaccgtggtcgcggaagtgtctctggccaaaattaatccagaagcaaac
catgaacacgtctgtctgctgggctgtggcgtgaccaccggtattggcgcggtgcacaac
acagctaaagtccagccaggtgattctgttgccgtgtttggtcttggcgcgattggtctg
gcagtggttcagggcgcgcgtcaggcgaaagcgggacggattatcgctatcgataccaac
ccgaagaaattcgatctggcgcgtcgcttcggtgctaccgactgcattaacccgaatgac
tacgacaaaccgattaaagatgtcctgctggatatcaacaaatggggtatcgaccatacc
tttgaatgcatcggtaacgtcaacgtgatgcgtgcggcgctggaaagtgcgcaccgcggc
tggggtcagtcggtgatcatcggggtggcaggttctggtcaggaaatctccacccgtcca
ttccagttggtcactggtcgcgtatggaaaggttccgcgtttggcggcgtgaaaggtcgt
tcccagttaccgggtatggttgaagatgcgatgaaaggtgatatcgatctggaaccgttt
gtcacgcataccatgagccttgatgaaattaatgacgccttcgacctgatgcatgaaggc
aaatccattcgaaccgtaattcgttactga

KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_11175Help
Entry
O3O_11175         CDS       T02256                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso00071  Fatty acid degradation
eso00350  Tyrosine metabolism
eso00620  Pyruvate metabolism
eso00625  Chloroalkane and chloroalkene degradation
eso00626  Naphthalene degradation
eso00650  Butanoate metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_11175
   00620 Pyruvate metabolism
    O3O_11175
   00650 Butanoate metabolism
    O3O_11175
  09103 Lipid metabolism
   00071 Fatty acid degradation
    O3O_11175
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    O3O_11175
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    O3O_11175
   00626 Naphthalene degradation
    O3O_11175
Enzymes [BR:eso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     O3O_11175
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     O3O_11175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: AFS85991
Position
2954126..2956801
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFATHGGYLLQGKELKAVQDVILKNGALNAAIVGQP
AYKIAELAGFSVPENTKILIGEVTVVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQPARVSYFGQKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSIVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHAME
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLETLKAELGIPKSIREAGVQEADFLANVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRDYVEGETAAKKEAAPAKAEKKAKKSA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcactcgtagagcgtgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagagcaagtagacaaaatcttccgcgccgccgctctg
gctgctgcagatgctcgaatcccactcgcgaaaatggccgttgccgaatccggcatgggt
atcgtcgaagataaagtgatcaaaaaccactttgcttctgaatatatctacaacgcctat
aaagatgaaaaaacctgtggtgttctgtctgaagacgacacttttggtaccatcactatc
gctgaaccaatcggtattatttgcggtatcgttccgaccactaacccgacttcaactgct
atcttcaaatcgctgatcagtctgaagacccgtaacgccattatcttctccccgcacccg
cgtgcaaaagatgccaccaacaaagcggctgatatcgttctgcaggctgctatcgctgcc
ggtgctccgaaagatctgatcggctggatcgatcaaccttctgttgaactgtctaacgca
ctgatgcaccacccagacatcaacctgatcctcgcgactggtggtccgggcatggttaaa
gccgcatacagctccggtaaaccagctatcggtgtaggcgcgggcaacactccagttgtt
atcgatgaaactgctgatatcaaacgtgcagttgcatctgtactgatgtccaaaaccttc
gacaacggcgtaatctgtgcttctgaacagtctgttgttgttgttgactctgtttatgac
gctgtacgtgaacgttttgcaacccacggcggctatctgttgcagggtaaagagctgaaa
gctgttcaggatgttatcctgaaaaacggtgcgctgaacgcggctatcgttggtcagcca
gcctataaaattgctgaactggcaggcttctctgtaccagaaaacaccaagattctgatc
ggtgaagtgaccgttgttgatgaaagcgaaccgttcgcacatgaaaaactgtccccgact
ctggcaatgtaccgcgctaaagatttcgaagacgcggtagaaaaagcagagaaactggtt
gctatgggcggtatcggtcatacctcttgcctgtacactgaccaggataaccaaccggct
cgcgtttcttacttcggtcagaaaatgaaaacggctcgtatcctgattaacaccccagcg
tctcagggtggtatcggtgacctgtataacttcaaactcgcaccttccctgactctgggt
tgtggttcttggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctccctgccaatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgactgaccgcttcctgttcaacaatggttatgctgatcagatcact
tccgtactgaaagcagcaggcgttgaaactgaagtcttcttcgaagtagaagcggacccg
accctgagcatcgttcgtaaaggtgcagaactggcaaactccttcaaaccagacgtgatt
atcgcgctgggtggtggttccccgatggacgccgcgaagatcatgtgggttatgtacgaa
catccggaaactcacttcgaagagctggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgctgtcaccaccacttctggt
acaggttctgaagtcactccgtttgcggttgtaactgacgacgctactggtcagaaatat
ccgctggcagactatgcgctgactccggatatggcgattgtcgacgccaacctggttatg
gacatgccgaagtccctgtgtgctttcggtggtctggacgcagtaactcacgccatggaa
gcttatgtttctgtactggcatctgagttctctgatggtcaggctctgcaggcactgaaa
ctgctgaaagaatatctgccagcgtcctaccacgaagggtctaaaaatccggtagcgcgt
gaacgtgttcacagtgcagcgactatcgcgggtatcgcgtttgcgaacgccttcctgggt
gtatgtcactcaatggcgcacaaactgggttcccagttccatattccgcacggtctggca
aacgccctgctgatttgtaacgttattcgctacaatgcgaacgacaacccgaccaagcag
actgcattcagccagtatgaccgtccgcaggctcgccgtcgttatgctgaaattgccgac
cacctgggtctgagcgcaccgggcgaccgtactgctgctaagatcgagaaactgctggca
tggctggaaacgctgaaagctgaactgggtattccgaaatctatccgtgaagctggcgtt
caggaagcagacttcctggcgaacgtggataaactgtctgaagatgcattcgatgaccag
tgcaccggcgctaacccgcgttacccgctgatctccgagctgaaacagattctgctggat
acctactacggtcgtgattatgtagaaggtgaaactgcagcgaagaaagaagctgctccg
gctaaagctgagaaaaaagcgaaaaaatccgcttaa

KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_12525Help
Entry
O3O_12525         CDS       T02256                                 

Definition
(GenBank) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso00071  Fatty acid degradation
eso00350  Tyrosine metabolism
eso00625  Chloroalkane and chloroalkene degradation
eso00626  Naphthalene degradation
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_12525
  09103 Lipid metabolism
   00071 Fatty acid degradation
    O3O_12525
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    O3O_12525
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    O3O_12525
   00626 Naphthalene degradation
    O3O_12525
Enzymes [BR:eso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     O3O_12525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AFS86257
Structure
PDB: 

Position
2682842..2683852
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcacgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaactggcgtaattctgggccatgaaggc
atcggtgtggtggcagaagttggccctggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctacgaaggatgcggtcattgcgaatactgtaatagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaaactgtcaaaaattcgt
ccagggcagtggattgctatctacggtcttggcggtctgggtaacctcgctctgcaatac
gcgaagaatgtctttaacgcgaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggtgcagatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggcgctcacgctgcggtggtaacagcagttgctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcggtcgtgttgtggctgtcggtctg
ccgccggagtctatgagcctggatatcccacgccttgtgctggatggcattgaagtggtc
ggttcgctggtcggcacgcgccaggatctaaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgttaa

KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_24770Help
Entry
O3O_24770         CDS       T02256                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso00071  Fatty acid degradation
eso00350  Tyrosine metabolism
eso00625  Chloroalkane and chloroalkene degradation
eso00626  Naphthalene degradation
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_24770
  09103 Lipid metabolism
   00071 Fatty acid degradation
    O3O_24770
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    O3O_24770
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    O3O_24770
   00626 Naphthalene degradation
    O3O_24770
Enzymes [BR:eso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     O3O_24770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Lamprin Inositol_P
Motif
Other DBs
NCBI-ProteinID: AFS88663
Position
168546..169697
Genome map
AA seq 383 aa AA seqDB search
MASSTFFIPSVNVIGADSLTDAMNMMADYGFTRTLIVTDSMLTKLGMAGDVQKALEERNI
FSVIYDGTQPNPTTENVAAGLKLLKENNCDSVISLGGGSPHDCAKGIALVAANGGDIRDY
EGVDRSAKPQLPMIAINTTAGTASEMTRFCIITDEARHIKMAIVDKHVTPLLSVNDSSLM
IGMPKSLTAATGMDALTHAIEAYVSIAATPITDACALKAVTMIAENLPLAVEDGSNAKAR
EAMAYAQFLAGMAFNNASLGYVHAMAHQLGGFYNLPHGVCNAVLLPHVQVFNSKVAAARL
RDCAAAMGVNVTGKNDAEGAEACINAIRELAKKVDIPAGLRDLNVKEEDFAVLATNALKD
ACGFTNPIQATHEEIVAIYRAAM
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttcaactttctttattccttctgtgaatgtcatcggcgctgattcattgact
gatgcaatgaatatgatggcagattatggatttacccgtaccttaattgtcactgacagt
atgttaacgaaattaggtatggcgggcgatgtgcaaaaagcactggaagaacgcaatatt
tttagcgttatttatgatggcacccaacctaaccccaccacggaaaacgtcgccgcaggt
ttgaaattacttaaagagaataattgcgatagcgtgatctccttaggcggtggttctcca
cacgactgcgcaaaaggtattgcgctggtggcagccaatggcggcgatattcgcgattac
gaaggcgttgaccgctctgcaaaaccgcagctgccgatgatcgccatcaataccacggcg
ggtacggcctctgaaatgacccgtttctgcatcatcactgacgaagcgcgtcatatcaaa
atggcgattgttgataaacatgtcactccgctgctttctgtcaatgactcctctctgatg
attggtatgccgaagtcactgaccgccgcaacgggtatggatgccttaacgcacgctatc
gaagcgtatgtttctattgccgccacgccgatcactgacgcttgtgcactgaaagccgtg
accatgattgccgaaaacctgccgttagccgttgaagatggcagtaatgcgaaagcgcgt
gaagcaatggcttatgcccagttcctcgccggtatggcgttcaataatgcttctctgggt
tatgttcatgcgatggcgcaccagctgggcggtttctacaacctgccacacggtgtatgt
aacgccgttttgctgccgcatgttcaggtattcaacagcaaagtcgccgccgcacgtctg
cgtgactgtgccgctgcaatgggcgtgaacgtgacaggtaaaaacgatgcggaaggtgct
gaagcctgcattaacgccatccgtgaactggcgaagaaagtggatatcccggcaggccta
cgcgacctgaacgtgaaagaagaagatttcgcggttctggcgactaatgccctgaaagat
gcctgtggttttactaacccgatccaggcaactcacgaagaaattgtggcgatttatcgc
gcagcgatgtaa

DBGET integrated database retrieval system