KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_05890Help
Entry
O3O_05890         CDS       T02256                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00730  Thiamine metabolism
eso00900  Terpenoid backbone biosynthesis
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01130  Biosynthesis of antibiotics
Module
eso_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    O3O_05890
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    O3O_05890
Enzymes [BR:eso01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     O3O_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C Transketolase_N
Motif
Other DBs
NCBI-ProteinID: AFS84948
Structure
PDB: 

Position
4028006..4029868
Genome map
AA seq 620 aa AA seqDB search
MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELT
VALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSV
GHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLND
NEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPIKELLKRTEEHIKGMVVPG
TLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIMTKKGRGYEPAEKDPITFHA
VPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFP
DRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDR
AGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGN
AVGVELTPLEKLPIGKGIVKRRGEKLAILNFGTLMPDAAKVAESLNATLVDMRFVKPLDE
ALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVPVLNIGLPDFFIPQGTQEEM
RAELGLGAAGMEAKIKAWLA
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgatattgccaaatacccgaccctggcactggtcgactccacccaggagtta
cgactgttgccgaaagagagtttaccgaaactctgcgacgaactgcgccgctatttactc
gacagcgtgagccgttccagcgggcacttcgcctccgggctgggcacggtcgaactgacc
gtggcgctgcactatgtctacaacaccccgtttgaccaattgatttgggatgtggggcat
caggcttatccgcataaaattttgaccggacgccgcgacaaaatcggcaccatccgtcag
aaaggcggcctgcacccgttcccgtggcgcggcgaaagcgaatatgacgtattaagcgtc
gggcattcatcaacctccatcagtgccggaattggtattgcggttgctgccgagaaagaa
ggcaaaaatcgccgtaccgtctgtgtaatcggcgatggcgcgattaccgcaggcatggcg
tttgaagcgatgaatcacgcgggcgatatccgtcctgatatgctggtggtcctcaacgac
aacgaaatgtcgatttccgaaaatgtcggcgcgctcaacaaccatctggcgcagctgctt
tccggtaagctttactcttcactgcgcgaaggcgggaaaaaagttttctctggcgttccg
ccaattaaagagctgctcaaacgtaccgaagaacatattaaaggcatggtagtgcctggc
acgttgtttgaagagctgggctttaactacatcggcccggttgacggtcacgatgtgctg
gggcttatcaccacgctgaagaacatgcgcgacctgaaaggcccgcagttcctgcatatc
atgaccaaaaaaggtcgtggttatgaaccggcagaaaaagaccccatcactttccacgcc
gtgcctaaatttgatccctccagcggttgtttgccgaaaagtagcggcggtttgccgagc
tattcaaaaatctttggcgactggttgtgcgaaacggcagcgaaagacaacaagctgatg
gcgattactccggcgatgcgtgaaggttccggcatggtcgagttttcacgtaaattcccg
gatcgttacttcgacgtggcaatcgccgagcaacacgcggtgacctttgccgccggtctg
gcgattggtgggtacaaacccattgtcgcgatttactccactttcctgcaacgcgcctat
gatcaggtgctgcatgacgtggcgattcaaaagctcccggtcctgttcgccatcgaccgc
gcgggcattgttggtgctgacggtcaaacccatcagggcgcttttgacctctcttacctg
cgctgcataccggaaatggtcattatgaccccgagcgatgaaaacgaatgtcgccagatg
ctctataccggctatcactataacgacggcccgtccgcggtgcgctacccgcgcggtaac
gcggttggcgtggaactgacgccgctggaaaaactgccaattggcaaaggcattgtgaag
cgtcgtggcgagaaactggcgatccttaactttggtacgctgatgccagacgcggcgaaa
gtcgctgaatcgctgaacgctacgctggtcgatatgcgttttgtgaaaccgcttgatgaa
gcgttaattctggaaatggccgccagccatgaagcgctggtcaccgtagaagaaaacgcc
attatgggcggcgcaggcagcggcgtgaacgaagtgctaatggcccatcgtaaaccagta
cccgtgctgaacattggcctgcctgacttctttattccacaaggaactcaggaagaaatg
cgcgccgaactcggcctcggtgccgccggtatggaagccaaaatcaaggcctggctggca
taa

DBGET integrated database retrieval system