KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_06535Help
Entry
O3O_06535         CDS       T02256                                 

Definition
(GenBank) DNA-binding transcriptional activator CusR
  KO
K07665  two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_06535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eso02022]
    O3O_06535
   01504 Antimicrobial resistance genes [BR:eso01504]
    O3O_06535
Two-component system [BR:eso02022]
 OmpR family
  CusS-CusR (copper tolerance)
   O3O_06535
Antimicrobial resistance genes [BR:eso01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    O3O_06535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C MutS_I
Motif
Other DBs
NCBI-ProteinID: AFS85076
Position
3881999..3882682
Genome map
AA seq 227 aa AA seqDB search
MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGW
DIVRMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGA
AVIIESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLEFFLRHQGEVLPRSLIASQVW
DMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYMLEVPDGQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttgattgtcgaagatgaaaagaaaaccggagaatacttgaccaaagggtta
accgaagccggttttgtggtcgatttggccgacaacgggttgaatggctaccatctggcg
atgaccggtgattatgatctgataatcctcgatattatgctgccggacgtgaacggctgg
gatatcgtgcgcatgttgcgttccgccaataaagggatgccgattctgttgcttaccgcg
cttggcaccattgaacatcgcgtcaaggggctggagttgggggcggatgactatctggtg
aagccgttcgcttttgctgaactgctggcgcgggtgcgcactctcctgcggcgcggggcg
gcggtgattatcgaaagtcagtttcaggttgccgatctgatggtcgatctcgtcagccgc
aaagtcacccgcagcggcacgcgcatcactctgaccagtaaagagtttactctgctggag
tttttcctccgccatcagggcgaagtgctgccccgctcgcttatcgcctcgcaggtgtgg
gacatgaatttcgacagcgacactaacgccattgatgtagcggtgaagcggctgcgcggc
aaaatcgacaacgactttgagccaaagctaattcagaccgtgcgcggcgtgggttacatg
cttgaggtgccggatggtcagtaa

KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_24055Help
Entry
O3O_24055         CDS       T02256                                 

Definition
(GenBank) Transcriptional regulatory protein pcoR
  KO
K07665  two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_24055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eso02022]
    O3O_24055
   01504 Antimicrobial resistance genes [BR:eso01504]
    O3O_24055
Two-component system [BR:eso02022]
 OmpR family
  CusS-CusR (copper tolerance)
   O3O_24055
Antimicrobial resistance genes [BR:eso01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    O3O_24055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AFS88524
Position
325413..326093
Genome map
AA seq 226 aa AA seqDB search
MQRILIVEDEQKTGRYLQQGLVEEGYQADLFNNGRDGLGAASKGQYDLIILDVMLPFLDG
WQIISALRESGHEEPVLFLTAKDNVRDKVKGLELGADDYLIKPFDFTELVARVRTLLRRA
RSQAATVCTIADMTVDMVRRTVIRSGKKIHLTGKEYVLLELLLQRTGEVLPRSLISSLVW
NMNFDSDTNVIDVAVRRLRSKIDDDFEPKLIHTVRGAGYVLEIREE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtattttaatcgttgaagacgaacaaaaaacaggtcgttacctgcagcaggga
ctggttgaggaaggctatcaggccgatctctttaataatggccgcgatggtctcggggcc
gcgtcgaagggacagtatgatttgataatactggacgtgatgctgcctttcctcgacggg
tggcaaatcatcagcgcactgagggagtccgggcacgaagaaccggtcctgtttttaacc
gcaaaggacaacgtgcgggacaaagtgaaaggactggagcttggcgcagatgactacctg
attaagccctttgattttacggagctggttgcacgtgtaagaaccctactgcgccgggca
cgctcgcaggccgcaacagtctgcaccatcgccgatatgaccgttgatatggtgcgccgg
accgtgatccgttcggggaagaagatccatctcaccggtaaagaatacgttctgcttgag
ttgctgctgcaacgcaccggagaagtgttacccaggagtcttatctcgtccctggtctgg
aacatgaattttgacagtgatacgaatgtgattgatgtcgccgtgagacgtctgagaagt
aaaattgatgatgactttgagccaaaactgatccataccgttcgcggtgccggatatgtc
ctggagatcagagaagagtga

KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_24130Help
Entry
O3O_24130         CDS       T02256                                 

Definition
(GenBank) DNA-binding transcriptional activator CusR
  KO
K07665  two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_24130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eso02022]
    O3O_24130
   01504 Antimicrobial resistance genes [BR:eso01504]
    O3O_24130
Two-component system [BR:eso02022]
 OmpR family
  CusS-CusR (copper tolerance)
   O3O_24130
Antimicrobial resistance genes [BR:eso01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    O3O_24130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AFS88539
Position
complement(309009..309689)
Genome map
AA seq 226 aa AA seqDB search
MKILIVEDEIKTGEYLSKGLTEAGFVVDHADNGLTGYHLAMTAEYDLVILDIMLPDVNGW
DIIRMLRTAGKGMPVLLLTALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGN
TMITESQFKVADLSIDLVSRKVSRAGNRIVLTSKEFSLLEFFIRHQGEVLPRSLIASQVW
DMNFDSDTNAIDVAVKRLRAKIDNDYETKLIQTVRGVGYMLEVPDA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattgatcgtcgaagacgaaattaaaacaggtgaatatctcagcaaagggctt
acagaggcagggttcgtagtggatcacgctgataatggtcttaccggatatcatctcgcc
atgacagccgagtatgatttagtcattctggatatcatgctacctgatgtgaacggctgg
gatatcatccgcatgctgcgcactgccggaaagggtatgccggtcttactgctgacagcc
ctcggcacgatcgaacatagggtcaaaggactggaactgggtgcggacgattatctggtt
aaaccctttgcgtttgccgaactgctcgcccgggtgagaacccttctgaggcggggaaac
acgatgatcacggaaagccagtttaaggtggctgacctctcgattgatctcgtatccaga
aaagtcagtcgcgccggaaaccgcattgtgctcaccagtaaagagttcagcctgctggaa
ttcttcattcgccatcagggagaggttcttccccgctccctgattgcctctcaggtctgg
gacatgaattttgacagcgacactaatgcgatcgatgtcgcagtaaagcgactccgcgct
aaaatagacaacgattacgagacaaagctgatccagacagtccggggcgtgggctacatg
ctggaggtcccggatgcatag

DBGET integrated database retrieval system