KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_07100Help
Entry
O3O_07100         CDS       T02256                                 

Definition
(GenBank) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso00030  Pentose phosphate pathway
eso00052  Galactose metabolism
eso00230  Purine metabolism
eso00500  Starch and sucrose metabolism
eso00520  Amino sugar and nucleotide sugar metabolism
eso00521  Streptomycin biosynthesis
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
Module
eso_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
eso_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_07100
   00030 Pentose phosphate pathway
    O3O_07100
   00052 Galactose metabolism
    O3O_07100
   00500 Starch and sucrose metabolism
    O3O_07100
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_07100
  09104 Nucleotide metabolism
   00230 Purine metabolism
    O3O_07100
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    O3O_07100
Enzymes [BR:eso01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     O3O_07100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFS85187
Position
complement(3760113..3761753)
Genome map
AA seq 546 aa AA seqDB search
MAIHNRAGQPAQQSDLINVAQLTAQYYVLKPEAGNAEHAVKFGTSGHRGSAARHSFNEPH
ILAIAQAIAEERAKNGITGPCYVGKDTHALSEPAFISVLEVLAANGVDVIVQENNGFTPT
PAISNAILVHNKKGGPLADGIVITPSHNPPEDGGIKYNPPNGGPADTNVTKVVEDRANAL
MADGLKGVKRISLDEAMASGHVKEQDLVQPFVEGLADIVDMAAIQKAGLTLGVDPLGGSG
IEYWKRIGEYYNLNLTIVNDQVDQTFRFMHLDKDGAIRMDCSSECAMAGLLALRDKFDLA
FANDPDYDRHGIVTPAGLMNPNHYLAVAINYLFQHRPQWGKDVAVGKTLVSSAMIDRVVN
DLGRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASFLRFDGTPWSTDKDGIIMCLLAAE
ITAVTGKNPQEHYNELAKRFGAPSYNRLQAAATSAQKAALSKLSPEMVSASTLAGDPITA
RLTAAPGNGASIGGLKVMTDNGWFAARPSGTEDAYKIYCESFLGEEHRKQIEKEAVEIVS
EVLKNA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcaatccacaatcgtgcaggccaacctgcacaacagagtgatttgattaacgtcgcc
caactgacggcgcaatattatgtactgaaaccagaagcagggaatgcggagcacgcggtg
aaattcggtacttccggtcaccgtggcagtgcagcgcgccacagctttaacgagccgcac
attctggcgatcgctcaggcaattgctgaagaacgtgcgaaaaacggcatcactggccct
tgctatgtgggtaaagatactcacgccctgtccgagcctgcgttcatttccgtactggaa
gtgctggcagcgaacggcgttgatgtcattgtgcaggaaaacaatggcttcactccgaca
cctgccatttccaatgccatcctggttcacaataaaaaaggtggcccgctggcagacggt
atcgtgattacaccgtcccataacccgccggaagatggtggtatcaagtacaacccgcca
aatggtggcccggctgataccaacgtcaccaaagtggtggaagacagggccaacgcactg
atggccgatggcctgaaaggcgtgaagcgtatctccctcgacgaagcgatggcatccggt
catgtaaaagagcaggatctggtgcagccgtttgtggaaggtctggccgatatcgttgat
atggcggcaattcagaaagcgggcctgacgctgggcgttgatccgctgggcggttccggt
atcgaatactggaagcgtattggcgagtattacaacctcaacctgaccatcgttaacgat
caggtcgatcaaaccttccgctttatgcaccttgataaagacggcgcgatccgtatggac
tgctcctccgagtgtgcgatggcgggcctgctggcactgcgtgataagttcgatctggcg
tttgctaacgacccggattatgaccgtcacggtatcgtcactccggcaggtttgatgaat
ccgaaccactacctggcggtggcgatcaactacctgttccagcatcgtccgcagtggggc
aaagatgttgctgtcggtaaaacgctggtttcttctgcgatgatcgaccgtgtggtcaat
gacttgggccgtaagctggtagaagtcccggtaggtttcaaatggtttgttgatggtctg
ttcgacggcagcttcggctttggcggcgaagagagcgcaggggcttccttcctgcgtttc
gacggcacgccgtggtccaccgacaaagacggcatcattatgtgtctgctggcggcggaa
atcaccgctgtcaccggtaagaacccgcaggaacactacaacgaactggcaaaacgcttt
ggtgcgccgagctacaaccgtttgcaggcagccgcgacttccgcacaaaaagcggcgctg
tctaagctgtctccggaaatggtgagcgccagcacccttgcaggcgacccgatcaccgcg
cgcctgacggcggcaccgggcaatggtgcttctatcggcggtctgaaagtgatgaccgac
aacggctggttcgccgcgcgtccgtcaggcacggaagacgcatataagatctactgcgaa
agcttcctcggtgaagaacatcgcaagcagattgagaaagaagcggttgagattgttagc
gaagttctgaaaaacgcgtaa

DBGET integrated database retrieval system