KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_10095Help
Entry
O3O_10095         CDS       T02256                                 

Definition
(GenBank) anti-sigma28 factor FlgM
  KO
K02398  negative regulator of flagellin synthesis FlgM
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02020  Two-component system
eso02026  Biofilm formation - Escherichia coli
eso02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_10095
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    O3O_10095
  09142 Cell motility
   02040 Flagellar assembly
    O3O_10095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:eso02035]
    O3O_10095
Bacterial motility proteins [BR:eso02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    O3O_10095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgM
Motif
Other DBs
NCBI-ProteinID: AFS85781
Position
3155115..3155408
Genome map
AA seq 97 aa AA seqDB search
MSIDRTSPLKPVSTVQPRETTDAPVTNSRAAKTTASTSTSVTLSDAQAKLMQPGSSDINL
ERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgatcgcacttcgcctctgaagcctgtaagcaccgttcaaccgcgcgaaacc
actgacgcgccggtaacgaacagccgggcggcaaaaacaaccgcctccaccagcaccagt
gtgacgttaagcgacgcgcaagcaaaactgatgcaacccggcagcagtgatatcaatctt
gaacgtgtcgaagcgttaaaactggcgattcgtaacggtgaactaaaaatggacaccggc
aaaattgccgatgcgctgatcaacgaagcgcagcaagacttgcagagtaactga

DBGET integrated database retrieval system