KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_10140Help
Entry
O3O_10140         CDS       T02256                                 

Gene name
flgI
Definition
(GenBank) flagellar basal body P-ring protein
  KO
K02394  flagellar P-ring protein precursor FlgI
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eso00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    O3O_10140 (flgI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:eso02035]
    O3O_10140 (flgI)
Bacterial motility proteins [BR:eso02035]
 Flagellar system
  Flagellar assembly proteins
   M,S,P and L rings
    O3O_10140 (flgI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgI SusE
Motif
Other DBs
NCBI-ProteinID: AFS85790
Position
complement(3147875..3148972)
Genome map
AA seq 365 aa AA seqDB search
MIKFLSALILLLVTTAAQAERIRDLTSVQGVRQNSLIGYGLVVGLDGTGDQTTQTPFTTQ
TLNNMLSQLGITVPTGTNMQLKNVAAVMVTASLPPFGRQGQTIDVVVSSMGNAKSLRGGT
LLMTPLKGVDSQVYALAQGNILVGGAGASAGGSSVQVNQLNGGRITNGAVIERELPSQFG
VGNTLNLQLNDEDFSMAQQIADTINRVRGYGSATALDARTIQVRVPSGNSSQVRFLADIQ
NMQVNVTPQDAKVVINSRTGSVVMNREVTLDSCAVAQGNLSVTVNRQANVSQPDTPFGGG
QTVVTPQTQIDLRQSGGSLQSVRSSASLNNVVRALNALGATPMDLMSILQSMQSAGCLRA
KLEII
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaatttctctctgcattaattcttctactggttacgacggcggctcaggctgag
cgtattcgcgatctcaccagtgttcagggggtaaggcaaaactcactgattggctatggc
ctggtggtggggctggatggaaccggtgaccagacgacccagacgccgtttaccacacaa
acgcttaataacatgctctcacagctgggaattaccgttccgacgggcaccaatatgcag
ctaaaaaacgtcgctgcggtaatggtgacagcgtcacttcctccgtttggacgtcagggg
caaaccatcgatgtggtggtttcctccatgggtaatgccaaaagcttgcgtggaggtacg
ttgttgatgacaccgcttaagggcgttgacagtcaggtgtatgcgctggcgcagggcaat
attctggttggcggcgcaggagcctccgctggcggtagcagtgttcaggtgaaccaactg
aacggtggacggatcaccaatggtgcggttattgaacgtgaattgcccagccagtttggc
gtcgggaatacccttaatttgcaacttaacgacgaagatttcagcatggcgcagcaaatc
gctgacaccatcaaccgcgtgcgtggatatggcagcgccaccgcgttagatgcgcggact
attcaggtgcgcgtaccaagtggcaacagttcccaggtccgtttccttgccgatatccag
aatatgcaggttaatgtcaccccgcaggacgctaaagtagtgattaactcgcgcaccggt
tcggtggtgatgaatcgcgaagtgaccctcgacagctgcgcggtagcgcagggaaatctc
tcagtaacagtcaatcgtcaggccaatgtcagccagccagatacaccgtttggtggtgga
cagactgtggttactccacaaacgcagatcgatttacgccagagcggcggttcgctgcaa
agcgtacgttccagcgccagcctcaataacgtggtgcgcgcgctcaatgcgctgggcgct
acgccgatggatctgatgtctattttgcaatcaatgcaaagtgcgggatgtctgcgggca
aaactggaaatcatctga

DBGET integrated database retrieval system