KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_11090Help
Entry
O3O_11090         CDS       T02256                                 

Definition
(GenBank) nitrate/nitrite sensor protein NarX
  KO
K07673  two-component system, NarL family, nitrate/nitrite sensor histidine kinase NarX [EC:2.7.13.3]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_11090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eso01001]
    O3O_11090
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eso02022]
    O3O_11090
Enzymes [BR:eso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     O3O_11090
Protein kinases [BR:eso01001]
 Histidine kinases
  NarL family
   O3O_11090
Two-component system [BR:eso02022]
 NarL family
  NarX-NarL (nitrate respiration)
   O3O_11090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA_3 HATPase_c HAMP PilJ HATPase_c_3 HATPase_c_2 Ni_hydr_CYTB NES_C_h PsbH
Motif
Other DBs
NCBI-ProteinID: AFS85977
Structure
PDB: 

Position
2974103..2975899
Genome map
AA seq 598 aa AA seqDB search
MLKRCLSPLTLVNQVALIVLLSTAIGLAGMAVSGWLVQGVQGSAHAINKAGSLRMQSYRL
LAAVPLSEKDKPLIKEMEQTAFSAELTRAAERDGQLAQLQGLQDYWRNELIPALMRAQNR
ETVSADVSQFVAGLDQLVSGFDRTTEMRIETVVLVHRVMAVFMALLLVFTIIWLRARLLQ
PWRQLLAMASAVSHRDFTQRANISGRNEMAMLGTALNNMSAELAESYAVLEQRVQEKTAG
LEHKNQILSFLWQANRRLHSRAPLCERLSPVLNGLQNLTLLRDIELRVYDTDDEENHQEF
TCQPDMTCDDKGCQLCPRGVLPVGDRGTTLKWRLADSHTQYGILLATLPQGRHLSHDQQQ
LVDTLVEQLTATLALDRHQERQQQLIVMEERATIARELHDSIAQSLSCMKMQVSCLQMQG
DALPESSRELLSQIRNELNASWAQLRELLTTFRLQLTEPGLRPALEASCEEYSAKFGFPV
KLDYQLPPRLVPSHQAIHLLQIAREALSNALKHSQASEVVVTVAQNDNQVKLTVQDNGCG
VPENAIRSNHYGMIIMRDRAQSLRGDCRVRRRESGGTEVVVTFIPEKTFTDVQGDTHE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaacgttgtctctctccgctcaccctggttaatcaggttgcgcttattgtgttg
ctttctactgctattggactggcagggatggcggtttctggctggctggtgcaaggcgtt
cagggcagcgcccatgcgatcaacaaagcgggatcgctgcgcatgcaaagttaccgtctg
ttggcggcagtgccattaagcgagaaagacaagcccttaattaaagagatggaacaaacg
gcatttagcgccgagttgactcgagcagcagaacgagacggacaactggcgcaattacag
ggtttacaagattactggcgtaatgaactgatccctgcgctgatgcgtgcacaaaaccga
gaaacggtgtcagcggatgtcagccagtttgttgccgggcttgatcagctggtatctggt
tttgaccgcaccacggaaatgcgcatcgagacagtggtactggtccatcgggtaatggcg
gtatttatggcacttttactggtgttcactattatctggttgcgggcgcgactgctacaa
ccgtggcggcaactgctggcaatggcgagtgccgtcagccatcgcgattttacccaacgc
gcaaacatcagcgggcgcaacgaaatggcgatgcttggaactgcgttgaacaatatgtct
gcagaactggccgaaagttatgccgtacttgagcagcgggttcaggagaaaaccgccggg
ctggagcataaaaatcagatcctctcatttttatggcaggctaaccgccgtttgcattcc
cgcgccccgctgtgtgaacgcctgtcaccggtactcaacggcttacagaatttaaccctg
ctacgtgatatcgaactgcgggtttatgatactgatgatgaagagaatcatcaggagttt
acctgccagccagatatgacttgtgatgataaaggctgccagctctgcccgcgcggcgta
ttacccgttggcgatcgcggcacaaccctgaagtggcggctggctgactctcatacgcag
tacggtattttgctggcgaccctgccgcaggggcgtcatcttagccatgatcaacaacaa
ctggtggataccctggttgaacaactcaccgccacgctggcgttggatcgccatcaggaa
cgtcagcaacagttgatcgtgatggaagagcgtgccaccattgcgcgcgaactgcatgat
tctattgcccaatctctctcttgtatgaagatgcaggtgagttgtttacagatgcagggc
gatgcgctgccagaaagcagccgcgaactgttaagtcagatccgtaacgaactgaatgca
tcctgggcgcagttgcgtgaattgctcaccacattccgcttgcagctcaccgagcctgga
ttacgtccggcgctggaggcgagttgcgaagagtacagcgccaaatttggcttcccggtg
aagctggattatcaattgccgcctcgtctggtgccttcgcatcaggcaatccacttgttg
caaattgcccgtgaggcattaagtaacgccctcaaacattcgcaagcgagtgaagtcgtg
gtgacggtggcgcaaaacgataatcaggtcaaactgaccgtccaggataacggctgcggc
gtgcctgaaaatgccatccgcagcaatcactacggcatgataataatgcgcgaccgtgcg
caaagtttacgaggcgattgccgcgtccgccgtcgtgaatcaggtggcaccgaagtggtg
gtcacctttattcccgaaaaaactttcacagacgtccaaggagatacccatgagtaa

DBGET integrated database retrieval system