KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_11600Help
Entry
O3O_11600         CDS       T02256                                 

Definition
(GenBank) bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase
  KO
K13497  anthranilate synthase/phosphoribosyltransferase [EC:4.1.3.27 2.4.2.18]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01130  Biosynthesis of antibiotics
eso01230  Biosynthesis of amino acids
Module
eso_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    O3O_11600
Enzymes [BR:eso01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     O3O_11600
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     O3O_11600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 GATase Glycos_trans_3N Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AFS86076
Position
2883895..2885490
Genome map
AA seq 531 aa AA seqDB search
MADILLLDNIDSFTYNLADQLRSNGHNVVIYRNHIPAQTLIERLATMSNPVLMLSPGPGV
PSEAGCMPELLTRLRGKLPIIGICLGHQAIVEAYGGYVGQAGEILHGKASSIEHDGQAMF
AGLTNPLPVARYHSLVGSNIPAGLTINAHFNGMVMAVRHDADRVCGFQFHPESILTTQGA
RLLEQTLAWAQQKLEPANTLQPILEKLYQAQTLSQQESHQLFSAVVRGELKPEQLAAALV
SMKIRGEHPNEIAGAATALLENAAPFPRPDYLFADIVGTGGDGSNSINISTASAFVAAAC
GLKVAKHGNRSVSSKSGSSDLLAAFGINLDMNADKSRQALDELGVCFLFAPKYHTGFRHA
MPVRQQLKTRTLFNVLGPLINPAHPPLALIGVYSPELVLPIAETLRVLGYQRAAVVHSGG
MDEVSLHAPTIVAELHDGEIKSYQLTAEDFGLTPYHQEQLAGGTPEENRDILTRLLQGKG
DAAHEAAVAANVAMLMRLHGHEDLQANAQTVLEVLRSGSAYDRVTALAARG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctgacatactgctgctcgataatatcgactcttttacgtacaacctggcagatcag
ttgcgcagcaatgggcataacgtggtgatttaccgcaaccatattccggcgcagacctta
attgaacgcctggcgaccatgagcaatccggtactgatgctttctcctggccccggtgtg
ccgagcgaagccggttgtatgccggaactccttacccgcttgcgtggcaagctgcccatt
attggcatttgcctcggacatcaggcaattgtcgaagcttacgggggctatgtcggtcag
gcgggcgaaattcttcacggtaaagcgtcgagcattgaacatgacggtcaggcgatgttt
gccggattaacaaacccgctgccggtggcgcgttatcactcgctggttggcagtaacatt
ccggccggtttaaccatcaacgcccattttaatggcatggtgatggcagtacgtcacgat
gcggatcgcgtttgtggattccagttccatccggaatccattctcaccacccagggcgct
cgcctgctggaacaaacgctggcctgggcgcagcagaaactagagccagccaacacgctg
caaccgattctggaaaaactgtatcaggcgcagacgcttagccaacaagaaagccaccag
ctgttttcagcggtggtgcgtggcgagctgaagccggaacaactggcggcggcgctggtg
agcatgaaaattcgcggtgagcacccgaacgagatcgccggagcagcaaccgcgctactg
gaaaacgccgcgccgttcccgcgcccggattatctgtttgctgatatcgtcggtactggc
ggtgacggcagcaacagtatcaatatttctaccgccagtgcgtttgtcgccgcggcctgt
gggctgaaagtggcgaaacacggcaaccgtagcgtctccagtaaatctggttcgtccgat
ctgctggcagcgttcggtattaatcttgatatgaacgccgataaatcgcgccaggcgctg
gatgagttaggtgtatgtttcctctttgcgccgaagtatcacaccggattccgccacgcg
atgccggttcgccagcaactgaaaacccgcaccctgttcaatgtgctggggccattgatt
aacccggcgcatccgccgctggcgttaattggtgtttatagtccggaactggtgctgccg
attgccgaaaccttgcgcgtgctggggtatcaacgcgcggcggtggtgcacagcggcggg
atggatgaagtttcattacacgcgccgacaatcgttgccgagctgcatgacggcgaaatt
aagagctatcaattgaccgctgaagattttggcctgactccctaccaccaggagcaactg
gcaggcggaacaccggaagaaaaccgtgacattttaacacgcttgttacaaggtaaaggc
gacgccgcccatgaagcagccgtcgctgcgaacgtcgccatgttaatgcgcctgcatggc
catgaagatctgcaagccaatgcgcaaaccgttcttgaggtactgcgcagtggttccgct
tacgacagagttaccgcgctggcggcacgagggtaa

DBGET integrated database retrieval system