KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_12215Help
Entry
O3O_12215         CDS       T02256                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
eso01230  Biosynthesis of amino acids
Module
eso_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eso_M00002  Glycolysis, core module involving three-carbon compounds
eso_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
eso_M00552  D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_12215
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eso04131]
    O3O_12215
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eso04147]
    O3O_12215
Enzymes [BR:eso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     O3O_12215
Membrane trafficking [BR:eso04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    O3O_12215
Exosome [BR:eso04147]
 Exosomal proteins
  Proteins found in most exosomes
   O3O_12215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N 2-Hacid_dh_C NAD_binding_3 TrkA_N FTO_NTD
Motif
Other DBs
NCBI-ProteinID: AFS86199
Position
2749794..2750795
Genome map
AA seq 333 aa AA seqDB search
MSKVGINGFGRIGRLVLRRLLEVKSNIDVVAINDLTSPKILAYLLKHDSNYGPFPWSVDF
TEDSLIVDGKSIAVYAEKEAKNIPWKAKGAEIIVECTGFYTSAEKSQAHLDAGAKKVLIS
APAGEMKTIVYNVNDDTLDGNDTIVSVASCTTNCLAPMAKALHDSFGIEVGTMTTIHAYT
GTQSLVDGPRGKDLRASRAAAENIIPHTTGAAKAIGLVIPELSGKLKGHAQRVPVKTGSV
TELVSILGKKVTAEEVNNALKQATTNNESFGYTDEEIVSSDIIGSHFGSVFDATQTEITA
VGDLQLVKTVAWYDNEYGFVTQLIRTLEKFAKL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagttggtattaacggttttggtcgtatcggtcgactggtgttgcgtcgatta
cttgaagtcaaaagcaacatagacgttgtcgctattaatgatctcacttccccaaaaatt
ctcgcctacctgctgaaacatgattcaaactacggaccattcccctggagcgttgatttt
acggaagattcacttatcgttgatgggaaaagtatcgcggtttacgccgaaaaagaggct
aaaaatattccgtggaaagcgaaaggtgcagaaatcattgtcgaatgtactggcttttat
acctccgccgagaaatcgcaggcgcatcttgatgctggtgcgaagaaggtgttgatttcc
gcccctgccggtgaaatgaaaactatcgtttataacgtcaatgacgacactctggatggc
aacgacaccattgtttccgtggcgtcatgcaccactaactgtcttgcgccgatggccaaa
gccttgcatgacagtttcgggatagaagtcggcacgatgacgaccattcatgcctatact
ggcacccagtcactggtggatggcccacgtggtaaagatttacgtgcttcacgcgcagcg
gcagaaaatatcattccccacactacgggggcggcaaaagccattggtctggtgatcccg
gaactgagcggcaaactgaaaggtcatgcgcaacgcgtgccggtgaaaacaggttcggtc
actgagctggtgtccattctcggaaaaaaagtgactgccgaagaggtgaataacgcactt
aaacaagcaaccaccaataacgagtcatttggttataccgatgaagaaatagtctcttcc
gatatcattggcagccatttcggttcggtgtttgatgccacgcaaacggaaattaccgcc
gtgggcgatttacaactggtgaaaacggtcgcctggtacgataacgaatatggcttcgtc
acgcagcttattcgcaccctcgaaaaattcgctaaactctga

KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_14560Help
Entry
O3O_14560         CDS       T02256                                 

Gene name
gapA
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase A
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
eso01230  Biosynthesis of amino acids
Module
eso_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eso_M00002  Glycolysis, core module involving three-carbon compounds
eso_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
eso_M00552  D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_14560 (gapA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eso04131]
    O3O_14560 (gapA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eso04147]
    O3O_14560 (gapA)
Enzymes [BR:eso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     O3O_14560 (gapA)
Membrane trafficking [BR:eso04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    O3O_14560 (gapA)
Exosome [BR:eso04147]
 Exosomal proteins
  Proteins found in most exosomes
   O3O_14560 (gapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AFS86659
Structure
PDB: 

Position
complement(2284938..2285933)
Genome map
AA seq 331 aa AA seqDB search
MTIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEV
KDGHLIVNGKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMT
GPSKDNTPMFVKGANFDKYAGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHATT
ATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSV
VDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIA
LNDNFVKLVSWYDNETGYSNKVLDLIAHISK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgactatcaaagtaggtatcaacggttttggccgtatcggtcgcattgttttccgtgct
gctcagaaacgttctgacatcgagatcgttgcaatcaacgacctgttagacgctgattac
atggcatacatgctgaaatatgactccactcacggccgtttcgacggtaccgttgaagtg
aaagacggtcatctgatcgttaacggtaaaaaaatccgtgttaccgctgaacgtgatccg
gctaacctgaaatgggacgaagttggtgttgacgttgtcgctgaagcaactggtctgttc
ctgactgacgaaactgctcgtaaacacatcaccgctggtgcgaagaaagtggttatgact
ggtccgtctaaagacaacactccgatgttcgttaaaggcgctaacttcgacaaatatgct
ggccaggacatcgtttccaacgcttcctgcaccaccaactgcctggctccgctggctaaa
gttatcaacgataacttcggcatcatcgaaggtctgatgaccaccgttcacgctactacc
gctactcagaaaaccgttgatggcccgtctcacaaagactggcgcggcggccgcggcgct
tcccagaacatcatcccgtcctctaccggtgctgctaaagctgtaggtaaagtactgcca
gaactgaatggcaaactgactggtatggcgttccgcgttccgaccccgaacgtatccgta
gttgacctgaccgttcgtctggaaaaagctgcaacttacgagcagatcaaagctgccgtt
aaagctgctgctgaaggcgaaatgaaaggcgttctgggctacaccgaagatgacgtagta
tctaccgatttcaacggcgaagtttgcacttccgtgttcgatgctaaagctggtatcgct
ctgaacgacaacttcgtgaaactggtatcctggtacgacaacgaaaccggttactccaac
aaagttctggacctgatcgctcacatctccaaataa

DBGET integrated database retrieval system