KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_12530Help
Entry
O3O_12530         CDS       T02256                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00620  Pyruvate metabolism
eso01200  Carbon metabolism
eso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3O_12530
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_12530
Enzymes [BR:eso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     O3O_12530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-ProteinID: AFS86258
Position
2681011..2682708
Genome map
AA seq 565 aa AA seqDB search
MEPKTKKQRSLYIPYAGPVLLEFPLLNKGSAFSMEERRNFNLLGLLPEVVETIEEQAERA
WIQYQGFKTEIDKHIYLRNIQDTNETLFYRLVNNHLDEMMPVIYTPTVGAACERFSEIYR
RSRGVFISYQNRHNMDDILQNVPNHNIKVIVVTDGERILGLGDQGIGGMGIPIGKLSLYT
ACGGISPAYTLPVVLDVGTNNQQLLNDPLYMGWRNPRITDDEYYEFVDEFIQAVKQRWPD
VLLQFEDFAQKNAMPLLNRYRNEICSFNDDIQGTAAVTVGTLIAASRAAGGQLSEKKIVF
LGAGSAGCGIAEMIISQTQREGLSEEAARQKVFMVDRFGLLTDKMPNLLPFQTKLVQKRE
NLSDWDTDSDVLSLLDVVRNVKPDILIGVSGQTGLFTEEIIREMHKHCPRPIVMPLSNPT
SRVEATPQDIIAWTEGNALVATGSPFNPVVWKDKIYPIAQCNNAFIFPGIGLGVIASGAS
RITDEMLMSASETLAQYSPLVLNGEGLVLPELKDIQKVSRAIAFAVGKMAQQQGVAVKTS
AEALQQAIDDNFWQAEYRDYRRTSI
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaaaaacaaaaaaacagcgttcgctttatatcccttacgctggccctgtactg
ctggaatttccgttgttgaataaaggcagtgccttcagcatggaagaacgccgtaacttc
aacctgctggggttactgccggaagtggtcgaaaccatcgaagaacaagcggaacgagca
tggatccagtatcagggattcaaaaccgaaatcgacaaacacatctacctgcgtaacatc
caggacactaacgaaaccctcttctaccgtctggtaaacaatcatcttgatgagatgatg
cctgttatttataccccaaccgtcggcgcagcctgtgagcgtttttctgagatctaccgc
cgttcacgcggcgtgtttatctcttaccagaaccggcacaatatggacgatattctgcaa
aacgtgccgaaccataatattaaagtgattgtggtgactgacggtgaacgtattctgggg
cttggtgaccagggcatcggtgggatgggcattccaatcggtaaactgtcgctctatacc
gcctgtggcggcatcagcccggcgtatacccttccggtggtgctggatgttgggaccaac
aaccagcagctgcttaacgatccgctgtatatgggctggcgtaatccacgtatcactgac
gatgaatactatgaattcgttgatgaatttatccaggctgtgaaacaacgctggccggac
gtgctgttgcagtttgaagactttgctcaaaaaaatgcgatgccgttacttaaccgctat
cgcaatgaaatttgttcttttaacgatgacattcagggcactgcggcggtaacagtcggc
acactgatcgcagccagccgcgcggcaggtggtcagttaagcgagaaaaaaatcgtcttc
cttggcgcaggttcagcgggatgcggcattgccgaaatgatcatctcccagacccagcgc
gaaggattaagcgaggaagcggcgcggcagaaagtctttatggtcgatcgctttggcttg
ctgaccgacaagatgccgaacctgctgcctttccagaccaaactggtgcagaagcgcgaa
aacctcagtgactgggataccgacagcgatgtgttgtcactgctggatgtggtgcgcaat
gtaaaaccagatattctgattggcgtctcaggacagaccgggctgtttacggaagagatc
attcgtgagatgcataaacactgtccgcgtccgatcgtgatgccgctgtctaacccgacg
tcacgcgtggaagccacaccgcaggacattatcgcctggaccgaaggtaacgcgctggtc
gccactggcagcccgtttaatccagtggtatggaaagataaaatctaccctatcgcccag
tgtaacaacgcctttattttcccgggcatcggcctgggggttattgcttccggcgcgtca
cgtatcaccgatgagatgctgatgtcggcaagtgaaacgcttgctcagtattcgccgctg
gtcctgaacggcgaaggtctggtactaccggaactgaaagatattcagaaagtctcccgc
gcaattgcgtttgcggttggcaaaatggcgcagcagcaaggcgtggcggtgaaaacgtct
gccgaagctctgcaacaggccattgatgataatttctggcaagccgaataccgcgactac
cgccgtacctccatctaa

DBGET integrated database retrieval system