KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_14935Help
Entry
O3O_14935         CDS       T02256                                 

Gene name
purT
Definition
(GenBank) phosphoribosylglycinamide formyltransferase 2
  KO
K08289  phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00230  Purine metabolism
eso00670  One carbon pool by folate
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    O3O_14935 (purT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    O3O_14935 (purT)
Enzymes [BR:eso01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     O3O_14935 (purT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp Dala_Dala_lig_C ATP-grasp_3 CPSase_L_D2 Epimerase 2-Hacid_dh_C LAL_C2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AFS86734
Structure
PDB: 

Position
complement(2214665..2215843)
Genome map
AA seq 392 aa AA seqDB search
MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVIN
MLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEEGLNVVPCARATKLTMNREGIRRL
AAEELQLPTSTYRFADSESLFREAVAAIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAWEY
AQQGGRAGAGRVIVEGVVKFDFEITLLTVSAVDGVHFCAPVGHRQEDGDYRESWQPQQMS
PLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQDLSEF
ALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVTFDNVQNAVGADLQIRLFGKPEIDG
SRRLGVALATAESVVDAIERAKHAAGQVKVQG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacgttattaggcactgcgctgcgtccggcagcaactcgcgtgatgttattaggctcc
ggtgaactgggtaaagaagtggcaatcgagtgtcagcgtctcggcgtagaggtgattgcc
gtcgatcgctatgccgacgcaccagccatgcatgtcgcgcatcgctcccatgtcattaat
atgcttgatggtgatgcattacgccgtgtggttgaactggaaaaaccacattatatcgtg
ccggagatcgaagctattgccaccgatatgctgatccaacttgaagaggaaggactgaat
gttgtcccctgcgctcgcgcaacgaaattaacgatgaatcgcgagggtatccgtcgcctg
gcggcagaagagctgcagctgcccacttccacttatcgttttgccgatagcgaaagcctt
ttccgcgaggcggttgccgccattggctatccctgcattgtaaaaccggtgatgagctct
tccggcaaggggcagacgtttattcgttctgcagagcaacttgctcaggcatgggaatac
gctcagcaaggcggtcgcgccggagcgggccgcgtaattgttgaaggcgtcgttaagttt
gacttcgaaattaccctgctaaccgtcagcgcggtggatggcgtccatttctgtgcacca
gtaggtcatcgccaggaagatggcgactaccgtgaatcctggcaaccacagcaaatgagc
ccgcttgcccttgaacgtgcgcaggagattgcccgtaaagtggtgctggcactgggcggt
tatggtctgtttggtgtcgagctgtttgtctgtggtgatgaggtgattttcagtgaggtc
tcccctcgtccacatgataccgggatggtgacgttaatttctcaagatctctcagagttt
gccctgcatgtacgtgccttcctcggacttcctgttggcgggatccgtcagtatggtcct
gcagcttctgccgttattctgccacaactgaccagtcagaatgtcacgtttgataatgtg
cagaatgccgtaggcgcagatttgcagattcgtttatttggtaagccggaaattgatggc
agccgtcgtctgggtgttgcgctggcgaccgctgagagtgttgttgacgccattgaacgc
gcgaagcacgccgccggacaggtaaaagtacagggttaa

KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_18730Help
Entry
O3O_18730         CDS       T02256                                 

Gene name
purN
Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00230  Purine metabolism
eso00670  One carbon pool by folate
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    O3O_18730 (purN)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    O3O_18730 (purN)
Enzymes [BR:eso01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     O3O_18730 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: AFS87477
Structure
PDB: 

Position
complement(1429650..1430288)
Genome map
AA seq 212 aa AA seqDB search
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASA
FDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHT
HRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDTEDDITARVQTQEHAIYPLV
ISWFADGRLKMHENAAWLDGQRLPPQGYAADE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgtggtgcttatttccggcaacggaagtaatttacaggcaattattgacgcc
tgtaaaaccaacaaaattaaaggcaccgtacgggcagttttcagcaataaggccgacgcg
ttcggccttgaacgcgcccgccaggcgggtattgcaacgcatacgctcatcgccagcgcg
tttgacagtcgtgaggcctatgaccgggagttgattcatgaaatcgacatgtacgcaccc
gatgtggtcgtgctggctggttttatgcgcattctcagcccggcgtttgtctcccactat
gccgggcgtttgctgaacattcacccttctctgctgccgaaatatcccggattacacacc
catcgtcaggcgctggaaaatggtgatgaagagcacggtacatcggtgcatttcgtcacc
gatgaactggacggtggcccggttattttacaggcgaaagtcccggtatttgctggtgat
acggaagatgacatcaccgcccgcgtgcaaacccaggaacacgctatttatccactggtg
attagctggtttgccgatggtcgtctgaaaatgcacgaaaacgccgcgtggctggatggt
caacgtctgccgccgcagggctacgctgccgacgagtaa

DBGET integrated database retrieval system