KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_15445Help
Entry
O3O_15445         CDS       T02256                                 

Definition
(GenBank) chemotaxis methyltransferase CheR
  KO
K00575  chemotaxis protein methyltransferase CheR [EC:2.1.1.80]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02020  Two-component system
eso02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:eso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_15445
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    O3O_15445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:eso02035]
    O3O_15445
Enzymes [BR:eso01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     O3O_15445
Bacterial motility proteins [BR:eso02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    O3O_15445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheR_N Methyltransf_12 Methyltransf_25 Methyltransf_11 Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: AFS86836
Position
2126461..2127321
Genome map
AA seq 286 aa AA seqDB search
MTSSLPCGQTSLLLQMTERLALSDAHFRRISQLIYQRAGIVLADHKRDMVYNRLVRRLRS
LGLTDFGHYLNLLESNQHSGEWQAFINSLTTNLTAFFREAHHFPLLADHARRRSGEYRVW
SAAASTGEEPYSIAMTLADTLGTAPGRWKVFASDIDTEVLEKARSGIYRHEELKNLTPQQ
LQRYFMRGTGPHEGLVRVRQELANYVDFAPLNLLAKQYTVPGPFDAIFCRNVMIYFDQNT
QQEILRRFVPLLKPDGLLFAGHSENFSHLERRFTLRGQTVYALSKD
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacttcatctctgccctgtgggcaaacgtctttattgttacagatgaccgagcgcctg
gcgctttccgacgcgcattttcggcggataagtcaattgatctatcaacgagccgggatc
gttctggctgaccataaacgcgacatggtttacaaccgactggttcgtcgtttgcgttcg
ctgggactgacggatttcggtcattatctgaacttgctggaatctaatcagcacagcggt
gagtggcaggcgtttatcaattcgctgaccacgaatctgacggcatttttccgtgaggca
caccatttccctctgctcgcggatcacgcacgtcgccgttctggcgagtatcgcgtatgg
agcgcggcggcttcgaccggcgaagagccgtacagcattgcgatgacgctggctgacaca
ttgggcaccgcgcccggacgctggaaagtgtttgccagtgatatcgacaccgaagtgctg
gaaaaagccagaagcggtatttatcgccatgaagagttgaaaaacctgacgccgcagcaa
ctgcaacggtatttcatgcgagggacgggaccgcatgaagggctggtacgcgtgcgtcag
gagctggcgaactatgttgattttgccccgctgaatctactggcgaaacagtacaccgtg
ccggggccgtttgatgcgatcttctgtcgtaacgtcatgatctacttcgatcaaaatacc
cagcaggagattttgcgccgctttgttccgctccttaaacccgacggattgctgtttgcg
ggtcactctgaaaactttagccaccttgagcgccgcttcacgctgcgtggtcagacggtg
tatgcgctaagtaaggattaa

DBGET integrated database retrieval system