KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_15465Help
Entry
O3O_15465         CDS       T02256                                 

Definition
(GenBank) chemotaxis protein CheA
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02020  Two-component system
eso02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:eso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_15465
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    O3O_15465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eso01001]
    O3O_15465
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eso02022]
    O3O_15465
   02035 Bacterial motility proteins [BR:eso02035]
    O3O_15465
Enzymes [BR:eso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     O3O_15465
Protein kinases [BR:eso01001]
 Histidine kinases
  CheA family [OT]
   O3O_15465
Two-component system [BR:eso02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   O3O_15465
Bacterial motility proteins [BR:eso02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    O3O_15465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW Hpt CheY-binding HATPase_c H-kinase_dim
Motif
Other DBs
NCBI-ProteinID: AFS86840
Structure
PDB: 

Position
2120501..2122465
Genome map
AA seq 654 aa AA seqDB search
MSMDISDFYQTFFDEADELLADMEQHLLVLQPEAPDAEQLNAIFRAAHSIKGGAGTFGFS
VLQETTHLMENLLDEARRGEMQLNTDIINLFLETKDIMQEQLDAYKQSQEPDAASFDYIC
QALRQLALEAKGETPSAVTRLSVVAKSEPQDEQSRSQSPRRIILSRLKAGEVDLLEEELG
HLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETVEVSPKISTPPVLKL
AAEQAPTGRVEREKTTRSNESTSIRVAVEKVDQLINLVGELVITQSMLAQRSSELDPVNH
GDLITSMGQLQRNARDLQESVMSIRMMPMEYVFSRYPRLVRDLAGKLGKQVELTLVGSST
ELDKSLIERIIDPLTHLVRNSLDHGIELPEKRLAAGKNSVGNLILSAEHQGGNICIEVTD
DGAGLNRERILAKAASQGLTVSENMSDDEVAMLIFAPGFSTAEQVTDVSGRGVGMDVVKR
NIQEMGGHVEIQSKQGTGTTIRILLPLTLAILDGMSVRVADEVFILPLNAVMESLQPREA
DLHPLAGGERVLEVRGEYLPIVELWKVFNVAGAKTEATQGIVVILQSGGRRYALLVDQLI
GQHQVVVKNLESNYRKVPGISAATILGDGSVALIVDVSALQAINREQRMANTAA
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatggatataagcgatttttatcagacattttttgatgaagcggacgaactgttg
gctgacatggagcagcatttgctggttttgcagccggaagcgccagatgccgaacaattg
aatgccatctttcgggctgcccactcgatcaaaggaggggcaggaacttttggcttcagc
gttttgcaggaaaccacgcatctgatggaaaacctgctcgatgaagccagacgaggtgag
atgcaactcaacaccgacattatcaatctgtttttggaaacgaaggacatcatgcaagaa
cagctcgacgcttataaacagtcgcaagagccggatgccgccagcttcgattatatctgc
caggccttgcgtcaactggcattagaagcgaaaggcgaaacgccatccgcagtgacccga
ttaagtgtggttgccaaaagtgaaccgcaagatgagcagagtcgcagtcagtcgccgcga
cgaattatcctttcgcgcctgaaggccggggaagtcgacctgctggaagaagaactggga
catctgacaacgttaactgacgtggtgaaaggggcggattcgctctcggcaatattaccg
ggcgacatcgccgaagatgacatcacagcggtactctgttttgtgattgaagccgatcag
attacctttgaaacagtagaagtctcgccaaaaatatccaccccaccagtgcttaaactg
gcagccgaacaagcgccaaccggccgcgtggagcgggaaaaaacgacgcgcagcaatgaa
tccaccagcatccgtgtagcggtagaaaaggttgatcaattaattaacctcgtcggcgag
ctggttatcacccagtccatgcttgcccagcgttccagcgaactggacccggttaatcat
ggtgatttgataaccagcatggggcagttacaacgtaacgcccgtgatttgcaggaatca
gtgatgtcgattcgcatgatgccgatggaatatgtttttagtcgctatccccggctggtg
cgtgatctggcgggaaaactcggcaagcaggtagaactgacgctggtgggcagttctact
gaactcgacaaaagcctgatagaacgcattatcgacccgctgacccacctggtacgcaat
agcctcgatcacggtattgaactgccagaaaaacggctcgccgcaggtaaaaacagcgtc
ggaaatttaattctgtctgccgaacatcagggcggtaacatttgcattgaagtgaccgac
gatggggcggggctaaaccgtgagcgaattctggcaaaagcggcctcgcaaggtttgact
gtcagcgaaaacatgagcgacgacgaagtcgcgatgctgatatttgcacctggcttctcc
acggcagagcaggtcaccgacgtctccgggcgcggcgtcggcatggacgtcgttaaacgt
aatatccaggagatgggcggtcatgtcgaaatccagtcgaagcagggtactggcactacg
atccgcattttactgccgctgacgctggccatcctcgacggcatgtccgtacgcgttgcg
gatgaagttttcattctgccgctgaatgctgttatggaatcactgcaaccccgtgaagcc
gatctccatccactggccggcggcgagcgggtgctggaagtgcggggtgaatatctgccc
atcgtcgaactgtggaaagtgttcaacgtcgcgggcgcgaaaaccgaagccacccaggga
attgtggtgatcttacaaagtggcggtcgccgctacgccttgctggtggatcaattaatt
ggtcaacaccaggttgtggttaaaaaccttgaaagtaactatcgcaaagtccccggcatt
tctgctgcgaccattcttggcgacggcagcgtggcactgattgttgatgtctccgccttg
caggcgataaaccgcgaacaacgtatggcgaacaccgccgcctga

DBGET integrated database retrieval system