KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_15475Help
Entry
O3O_15475         CDS       T02256                                 

Definition
(GenBank) flagellar motor protein MotA
  KO
K02556  chemotaxis protein MotA
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02020  Two-component system
eso02030  Bacterial chemotaxis
eso02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_15475
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    O3O_15475
   02040 Flagellar assembly
    O3O_15475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eso02000]
    O3O_15475
   02035 Bacterial motility proteins [BR:eso02035]
    O3O_15475
Transporters [BR:eso02000]
 Other Transporters
  Pores ion channels [TC:1]
   O3O_15475
Bacterial motility proteins [BR:eso02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    O3O_15475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB SpoVAB YopD Podoplanin
Motif
Other DBs
NCBI-ProteinID: AFS86842
Position
2118686..2119573
Genome map
AA seq 295 aa AA seqDB search
MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKA
LPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADS
VMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAA
VMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETSKMMQC
VKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQQTTTEEA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgcttatcttattaggttacctggttgttctcggtacagttttcggcggttatttgatg
accggtggaagccttggagcactctatcaacccgctgaactggtgattattgccggtgca
gggattgggtcgtttatcgtcggcaataatggcaaagcgattaaaggcacgctgaaggcg
ctgccgttgctgtttcgtcgctccaaatacaccaaagcaatgtatatggatctgctggct
ctgctttatcggttgatggcaaaatcgcggcagatggggatgttttcgctggaacgtgat
attgaaaatccccgtgagagcgagatcttcgccagctacccacgcatcctcgcggatagc
gtcatgcttgattttatcgtcgattatctgcgcctgattatcagcggtcacatgaacacc
ttcgaaatcgaagccctgatggatgaagagattgagacgcacgaaagcgaggcagaagtc
ccggcgaacagtctggcgctggtcggggactcacttccggcgtttggtattgttgcggct
gtaatgggggtcgttcacgcgttaggttcagccgatcgtcctgccgccgagctgggtgcg
cttatcgcacatgcgatggtggggactttcctcggcattttattggcttacggatttatt
tccccattagcgactgttttacgtcagaaaagcgccgaaaccagcaaaatgatgcagtgc
gtcaaagtcactctgctttctaatctgaacggttacgcaccgcctatcgccgttgagttt
ggtcgcaaaacgctctattccagcgaacgtccgtcgtttattgaactggaagagcatgtg
cgtgcggtgaaaaatccgcaacaacagacgacaaccgaggaagcatga

DBGET integrated database retrieval system