KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_15610Help
Entry
O3O_15610         CDS       T02256                                 

Gene name
fliA
Definition
(GenBank) flagellar biosynthesis sigma factor
  KO
K02405  RNA polymerase sigma factor for flagellar operon FliA
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02020  Two-component system
eso02026  Biofilm formation - Escherichia coli
eso02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_15610 (fliA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    O3O_15610 (fliA)
  09142 Cell motility
   02040 Flagellar assembly
    O3O_15610 (fliA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:eso03021]
    O3O_15610 (fliA)
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:eso02035]
    O3O_15610 (fliA)
Transcription machinery [BR:eso03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     O3O_15610 (fliA)
Bacterial motility proteins [BR:eso02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    O3O_15610 (fliA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r3 Sigma70_r4 Sigma70_r2 Sigma70_r4_2 UPF0147 UPF0122 TFIIE_alpha
Motif
Other DBs
NCBI-ProteinID: AFS86869
Position
2094813..2095532
Genome map
AA seq 239 aa AA seqDB search
MNSLYTAEGVMDKHSLWQRYVPLVRHEALRLQVRLPASVELDDLLQAGGIGLLNAVERYD
ALQGTAFTTYAVQRIRGAMLDELRSRDWVPRSVRRNAREVAQAIGQLEQELGRNATETEV
AERLGIDIADYRQMLLDTNNSQLFSYDEWREEHGDSIELVTDDHQRENPLQQLLDSNLRQ
RVMEAIETLPEREKLVLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRTKLGKL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcactctataccgctgaaggtgtaatggataaacactcgctgtggcagcgttat
gtcccgctggtgcgtcacgaagcattgcgcctgcaggttcgactgcccgcgagcgtggaa
cttgacgatctgctacaggcgggcggcattgggttacttaatgccgtcgaacgctatgac
gccctacaaggaacggcatttacaacttacgcagtgcagcgtatccgtggcgctatgctg
gatgaacttcgcagccgtgactgggtgccgcgcagcgtgcgacgcaacgcgcgtgaagtg
gcacaggcaatagggcaactggagcaggaacttggccgcaacgccacggaaactgaggta
gcggaacgtttagggatcgatattgccgattatcgccaaatgttgctcgacaccaataac
agccagctcttctcctacgatgagtggcgcgaagagcacggcgatagcatcgaactggtt
actgatgatcatcagcgagaaaacccgctacaacaactgctggacagtaatctgcgtcag
cgggtgatggaagccatcgaaacgttgccggagcgcgaaaaactggtattaaccctctat
taccaggaagagctgaatctcaaagagattggcgcggtgctggaggtcggggaatcgcgg
gtcagtcagttacacagccaggctattaaacggttacgcactaaactgggtaagttataa

DBGET integrated database retrieval system