KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_15720Help
Entry
O3O_15720         CDS       T02256                                 

Gene name
fliM
Definition
(GenBank) flagellar motor switch protein FliM
  KO
K02416  flagellar motor switch protein FliM
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02030  Bacterial chemotaxis
eso02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eso00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    O3O_15720 (fliM)
   02040 Flagellar assembly
    O3O_15720 (fliM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:eso02035]
    O3O_15720 (fliM)
Bacterial motility proteins [BR:eso02035]
 Flagellar system
  Flagellar assembly proteins
   C-ring
    O3O_15720 (fliM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliM FliMN_C
Motif
Other DBs
NCBI-ProteinID: AFS86891
Position
complement(2075397..2076401)
Genome map
AA seq 334 aa AA seqDB search
MGDSILSQAEIDALLNGDSEVKDEPTASVSGESDIRPYDPNTQRRVVRERLQALEIINER
FARHFRMGLFNLLRRSPDITVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSP
SLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYV
RSEMQVKFTNITTSPNDIVVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSR
NEDQNWRDNLVRQVQHSQLELVANFADISLRLSQILKLKPGDVLPIEKPDRIIAHVDGVP
VLTSQYGTLNGQYALRIEHLINPILNSLNEEQPK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatagtattctttctcaagctgaaattgatgcgctgttgaatggtgacagcgaa
gtcaaagacgaaccgacagccagtgttagcggcgaaagtgacattcgtccgtacgatccg
aatacccaacgacgggttgtgcgcgaacgtttgcaggcgctggaaatcattaatgagcgc
tttgcccgccattttcgtatggggctgttcaacctgctgcgtcgtagcccggatataacc
gtcggggccatccgcattcagccgtaccatgaatttgcccgcaacctgccggtgccgacc
aacctgaaccttatccatctgaaaccgctgcgcggcacagggctggtggtgttttcaccg
agtctggtgtttatcgccgtggataacctgtttggcggcgatggacgcttcccgaccaaa
gtggaaggtcgcgagtttacccataccgaacagcgcgtcatcaaccgcatgttaaagctg
gcgcttgaaggctatagcgacgcctggaaggcgattaatccgctggaagttgagtacgtg
cgttcggaaatgcaggtgaaatttaccaatatcaccacctcgccgaacgacattgtggtt
aacacgccgttccatgtggagattggcaacctgaccggcgaatttaatatctgcctgcca
ttcagcatgatcgagccgctacgggaattgttggttaacccgccgctggaaaactcgcgt
aatgaagatcagaactggcgcgataacctggtgcgccaggtgcagcattcacagctggag
ttggtcgccaactttgccgatatctcgctacgcctgtcgcagattttaaaactgaaaccc
ggcgacgtcctgccgatagaaaaacccgaccgcatcatcgcccatgttgacggcgtcccg
gtgctgaccagtcagtacggcactctcaacggtcagtatgcgttacggatagaacatttg
attaacccgattttaaattctctgaacgaggaacagcccaaatga

DBGET integrated database retrieval system