KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_16660Help
Entry
O3O_16660         CDS       T02256                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K11645  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso00030  Pentose phosphate pathway
eso00051  Fructose and mannose metabolism
eso00680  Methane metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
eso01230  Biosynthesis of amino acids
Module
eso_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eso_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_16660
   00030 Pentose phosphate pathway
    O3O_16660
   00051 Fructose and mannose metabolism
    O3O_16660
  09102 Energy metabolism
   00680 Methane metabolism
    O3O_16660
Enzymes [BR:eso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     O3O_16660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: AFS87069
Position
1873786..1874838
Genome map
AA seq 350 aa AA seqDB search
MTDIAQLLGKDADNLLQHRCMTIPSDQLYLPGHDYVDRVMIDNNRPPAVLRNMQTLYNTG
RLAGTGYLSILPVDQGVEHSAGASFAASPLYFDPKNIVELAIEAGCNCVASTYGVLASVS
RRYAHRIPFLVKLNHNETLSYPNTYDQTLYASVEQAFNMGAVAVGATIYFGSEESRRQIE
EISAAFERAHELGMVTVLWAYLRNSAFKKDGVDYHVSADLTGQANHLAATIGADIVKQKM
AENNGGYKAINYGYTDDRVYSKLTSENPIDLVRYQLANCYMGRAGLINSGGAAGGETDLS
DAVRTAVINKRAGGMGLILGRKAFKKSMADGVKLINAVQDVYLDSKITIA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacagatattgcgcagttgcttggcaaagacgccgacaaccttttacagcaccgttgt
atgacaattccttctgaccagctttatctccccggacatgactacgtagaccgcgtaatg
attgacaataatcgcccgccagcggtgttacgtaatatgcagacgttgtacaacaccggg
cgtctggctggcacaggatatctttctattctgccggttgaccagggcgttgagcactct
gccggagcttcatttgctgctagcccgctctactttgacccgaaaaacattgttgaactg
gcgatcgaagcgggctgtaactgtgtggcgtcaacttacggcgtgctggcgtcggtatcg
cggcgttatgcgcatcgcattccattcctcgtcaaacttaatcacaacgagacgctaagt
tacccgaatacctacgatcaaacgctgtatgccagcgtggagcaggcgttcaacatgggc
gcggttgcggttggtgcgactatctattttggctcggaagagtcacgtcgccagattgaa
gaaatttctgcggcttttgaacgtgcgcacgagctgggtatggtgacagtgctgtgggcc
tatttgcgtaactccgcctttaagaaagatggcgttgattaccatgtttccgccgacctg
accggtcaggcaaaccatctggcggcaaccatcggtgcagatatcgtcaaacaaaaaatg
gcggaaaataacggcggctataaagcaattaattacggttacaccgacgatcgtgtttac
agcaaattgaccagcgaaaacccgattgatctggtgcgttatcagttagctaactgctat
atgggtcgggctgggttgataaactccggcggtgctgcgggcggtgaaactgacctcagc
gatgcagtgcgtactgcggttatcaacaaacgcgctggcggaatggggctgattcttgga
cgtaaggcgttcaagaaatcgatggctgacggcgtgaaactgattaatgccgtgcaggac
gtttatctcgatagcaaaattactattgcctga

KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_20805Help
Entry
O3O_20805         CDS       T02256                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso00030  Pentose phosphate pathway
eso00051  Fructose and mannose metabolism
eso00680  Methane metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
eso01230  Biosynthesis of amino acids
Module
eso_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eso_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_20805
   00030 Pentose phosphate pathway
    O3O_20805
   00051 Fructose and mannose metabolism
    O3O_20805
  09102 Energy metabolism
   00680 Methane metabolism
    O3O_20805
Enzymes [BR:eso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     O3O_20805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase S-methyl_trans MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: AFS87881
Structure
PDB: 

Position
980632..981711
Genome map
AA seq 359 aa AA seqDB search
MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQ
FSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWI
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTG
GEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPT
ILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGV
LNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagatttttgatttcgtaaaacctggcgtaatcactggtgatgacgtacagaaa
gttttccaggtagcaaaagaaaacaacttcgcactgccagcagtaaactgcgtcggtact
gactccatcaacgccgtactggaaactgctgctaaagttaaagcgccggttatcgttcag
ttctccaacggtggtgcttcctttatcgctggtaaaggcgtgaaatctgacgttccgcag
ggtgctgctatcctgggcgcgatctctggtgcgcatcacgttcaccagatggctgaacat
tatggtgttccggttatcctgcacactgaccactgcgcgaagaaactgctgccgtggatc
gacggtctgctggacgcgggtgaaaaacacttcgcagctaccggcaagccgctgttctct
tctcacatgatcgacctgtctgaagaatctctgcaagagaacatcgaaatctgctctaaa
tacctggagcgtatgtccaaaatcggcatgactctggaaatcgaactgggttgcaccggt
ggtgaagaagacggcgtggacaacagccacatggacgcttctgcactgtacacccagccg
gaagacgttgattacgcatacaccgaactgagcaaaatcagcccgcgtttcaccatcgca
gcgtccttcggtaacgtacacggtgtttacaagccgggtaacgtggttctgactccgacc
atcctgcgtgattctcaggaatatgtttccaagaaacacaacctgccgcacaacagcctg
aacttcgtattccacggtggttccggttctactgctcaggaaatcaaagactccgtaagc
tacggcgtagtaaaaatgaacatcgataccgatacccaatgggcaacctgggaaggcgtt
ctgaactactacaaagcgaacgaagcttatctgcagggtcagctgggtaacccgaaaggt
gaagatcagccgaacaagaaatactacgatccgcgcgtatggctgcgtgccggtcagact
tcgatgatcgctcgtctggaaaaagcattccaggaactgaacgcgatcgacgttctgtaa

DBGET integrated database retrieval system