KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_17315Help
Entry
O3O_17315         CDS       T02256                                 

Definition
(GenBank) bifunctional 3-demethylubiquinone-9 3-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00130  Ubiquinone and other terpenoid-quinone biosynthesis
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
Module
eso_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    O3O_17315
Enzymes [BR:eso01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     O3O_17315
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     O3O_17315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 Ubie_methyltran CMAS NodS MTS Methyltransf_9 PrmA MetW Methyltransf_32 Sterol_MT_C TPMT DREV GidB
Motif
Other DBs
NCBI-ProteinID: AFS87199
Structure
PDB: 

Position
complement(1719606..1720328)
Genome map
AA seq 240 aa AA seqDB search
MNAEKSPENHNVDHEEIAKFEAVASRWWDLEGEFKPLHRINPLRLGYIAERAGGLFGKKV
LDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIQVDYVQETVEEHAAKHA
GQYDVVTCMEMLEHVPDPQSVVRACAQLVKPGGDVFFSTLNRNGKSWLMAVVGAEYILRM
VPKGTHDVKKFIKPAELLGWVDQTSLKERHITGLHYNPLTNTFKLGPGVDVNYMLHTQNK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgaaaaatcgccggaaaaccataacgtagaccacgaagagatcgctaaattt
gaagccgtcgcctcccgctggtgggatcttgaaggtgagttcaaaccgttgcaccgcatt
aacccgctgcgtctgggctatattgccgagcgtgctggcggtttatttggcaaaaaggtg
ctcgatgtcggttgtggcggcggcattctggccgagagtatggcgcgcgaaggcgcgacg
gtgaccggtctggatatgggctttgagccattgcaggtggcaaaactgcacgcgctggaa
agcggcattcaggtggattatgtgcaggaaaccgtggaagagcacgcggcaaaacatgcc
gggcagtatgatgtggtgacctgcatggagatgctggagcacgtccccgatccgcagtca
gtggtcagagcctgtgcgcaactggtgaaaccaggcggcgatgtctttttctcgacgctt
aaccgcaacggcaagtcatggctgatggcggtggttggcgcggaatatattttgcgcatg
gtgcccaaaggcacgcatgatgtgaagaagtttattaaaccggcagaactgcttggctgg
gtagatcagacaagccttaaagagcgacatataaccgggctacattacaacccgctcact
aatacttttaaactcggccccggcgtggatgtgaactatatgctgcacacgcagaataag
tga

DBGET integrated database retrieval system