KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_17455Help
Entry
O3O_17455         CDS       T02256                                 

Definition
(GenBank) O-succinylbenzoate synthase
  KO
K02549  O-succinylbenzoate synthase [EC:4.2.1.113]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00130  Ubiquinone and other terpenoid-quinone biosynthesis
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
Module
eso_M00116  Menaquinone biosynthesis, chorismate => menaquinol
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    O3O_17455
Enzymes [BR:eso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     O3O_17455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C Enolase_like_N
Motif
Other DBs
NCBI-ProteinID: AFS87227
Structure
PDB: 

Position
1686954..1687916
Genome map
AA seq 320 aa AA seqDB search
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGEREGWGEISPLPGFSQETWEEAQ
SVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELADTLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRHRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSTLPVVEVDALERLL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagcgcgcaggtataccgctggcagatccccatggacgcgggggtggttctgcgc
gacaggcggttaaaaacccgcgacgggctgtacgtttgcctgcgtgagggcgagcgcgaa
gggtggggggagatctccccactgccgggcttcagccaggaaacctgggaagaggcgcaa
agcgtgctgcttgcctgggtaaataactggctggcaggcgattgcgagctaccgcagatg
ccttccgttgcctttggcgtaagctgtgcattggcggagctggcagatacgctcccgcag
gcggccaattaccgtgcggcaccactgtgtaatggcgatcctgacgatctgatcctcaaa
cttgctgatatgccaggcgagaaagtggcgaaggtcaaagtgggattgtacgaagccgtg
cgcgacggcatggtggttaatctgttgctggaggcaattccggatctgcatttgcgtctt
gacgcaaatcgcgcctggacaccgctgaaaggccagcagtttgccaaatatgttaacccg
gattatcgccaccgcatcgcgtttctcgaagagccgtgcaaaacccgcgatgattcgcga
gcgtttgcccgtgaaaccggcattgccattgcctgggatgaaagcctgcgcgagccggat
tttgcctttgtggctgaagagggcgtgcgtgcggtagttatcaaacccacgctcacgggc
agtctggagaaagtacgcgagcaggtacaggcggcgcacgcgctggggctgacggcggtg
atcagttcttccattgaatcgagcttaggcttaacgcaactggcgcggattgccgcctgg
ttaacgccggacaccattccagggctggacacgctggatctgatgcaggcgcagcaggta
cgtcgctggccgggtagcacgctgcctgtcgtggaagttgatgcactggagcggttgtta
tga

DBGET integrated database retrieval system