KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_17465Help
Entry
O3O_17465         CDS       T02256                                 

Definition
(GenBank) 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
  KO
K08680  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00130  Ubiquinone and other terpenoid-quinone biosynthesis
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
Module
eso_M00116  Menaquinone biosynthesis, chorismate => menaquinol
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    O3O_17465
Enzymes [BR:eso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     O3O_17465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Thioesterase Lipase_3
Motif
Other DBs
NCBI-ProteinID: AFS87229
Structure
PDB: 

Position
1685324..1686082
Genome map
AA seq 252 aa AA seqDB search
MILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDG
FDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQ
RAERQRSDRQWAQRFRTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAML
EATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPA
GVIASLAQILRF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcacgcgcaggcaaaacacggaaaaccaggtttaccctggctggtgtttttg
cacggtttttccggcgattgccacgaatggcaagaagtgggcgaggcgtttgccgactac
tcacggttgtatgttgatctcccaggtcatggtggttcggcggcgattagcgtcgatgga
tttgatgatgtcaccgacttactgcgtaaaaccttggttagttacaacatccttgacttc
tggctggtggggtactcgcttggcggacgggtggcgatgatggcggcttgccaggggctg
gcggggctttgtggggttattgtcgaaggcgggcatccggggctgcaaaatgctgaacaa
cgtgcggaacgtcagcgttccgatcgccaatgggcgcagcgttttcgcacagaaccgtta
acggcggtatttgccgactggtatcaacagcctgtttttgcctcgctcaatgacgatcaa
cgccgggagctggtggcgctgcgcagcaacaataatggcgcaacccttgccgccatgctg
gaggcgacttctctcgccgtccagcctgatttacgtgctaaccttagcgcccgcacattt
gcgttttattatttatgtggtgaacgtgacagcaaattccgcgccctggcggcggaactg
gctgccgactgccatgtcattcctcgcgccggacataacgcgcatcgggaaaatcccgct
ggcgttatcgcaagtctggcgcagatcttgcgtttctga

DBGET integrated database retrieval system