KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_18220Help
Entry
O3O_18220         CDS       T02256                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso00052  Galactose metabolism
eso00500  Starch and sucrose metabolism
eso00520  Amino sugar and nucleotide sugar metabolism
eso00521  Streptomycin biosynthesis
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
Module
eso_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eso_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_18220 (glk)
   00052 Galactose metabolism
    O3O_18220 (glk)
   00500 Starch and sucrose metabolism
    O3O_18220 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_18220 (glk)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    O3O_18220 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    O3O_18220 (glk)
Enzymes [BR:eso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     O3O_18220 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AFS87375
Structure
PDB: 

Position
1534579..1535544
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcaatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtagaaggtaaacctattgcggtttacggtgccggaacagggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccgggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagaggccattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggagcgcgtgctttctggccctgggctggtgaatttgtatcgc
gcaattgtgaaagctgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgcgcattgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggcggtatcgtgccgcgcttccttgagttcttcaaagcctctggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
catgacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system