KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_18990Help
Entry
O3O_18990         CDS       T02256                                 

Gene name
glyA
Definition
(GenBank) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00260  Glycine, serine and threonine metabolism
eso00460  Cyanoamino acid metabolism
eso00630  Glyoxylate and dicarboxylate metabolism
eso00670  One carbon pool by folate
eso00680  Methane metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
eso01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    O3O_18990 (glyA)
  09102 Energy metabolism
   00680 Methane metabolism
    O3O_18990 (glyA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    O3O_18990 (glyA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    O3O_18990 (glyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    O3O_18990 (glyA)
Enzymes [BR:eso01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     O3O_18990 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2 Aminotran_5 Beta_elim_lyase OKR_DC_1 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AFS87529
Structure
PDB: 

Position
1367658..1368911
Genome map
AA seq 417 aa AA seqDB search
MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYP
GKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLGMN
LAHGGHLTHGSPVNFSGKLYNIVPYGIDATGHIDYADLEKQAKEHKPKMIIGGFSAYSGV
VDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLIL
AKGGSEELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVE
VFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTS
GIRVGTPAITRRGFKEAEAKELAGWMCDVLDSINDEAVIERIKGKVLDICARYPVYA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcgtgaaatgaacattgccgattatgatgccgaactgtggcaggctatggag
caggaaaaagtacgtcaggaagagcacatcgaactgatcgcctccgaaaactacaccagc
ccgcgcgtaatgcaggcgcagggttctcagctgaccaacaaatatgctgaaggttatccg
ggcaaacgctactacggcggttgcgagtatgttgatatcgttgaacaactggcgatcgat
cgtgcgaaagaactgttcggcgctgactacgctaacgtccagccgcactccggctcccag
gctaactttgcggtctacaccgcgctgctggaaccaggtgataccgttctgggtatgaac
ctggcgcatggcggtcacctgactcacggttctccggttaacttctccggtaaactgtac
aacatcgttccttacggtatcgatgctaccggtcatatcgactacgccgatctggaaaaa
caagccaaagaacacaagccgaaaatgattatcggtggtttctctgcatattccggcgtg
gttgactgggcgaaaatgcgtgaaatcgctgacagcatcggtgcttacctgttcgttgat
atggcgcacgttgcgggcctggttgctgctggcgtctacccgaacccggttcctcatgct
cacgttgttactaccaccactcacaaaaccctggcgggtccgcgcggcggcctgatcctg
gcgaaaggtggtagcgaagagctgtacaaaaaactgaactctgccgttttccctggtggt
cagggcggtccgttgatgcacgtaatcgccggtaaagcggttgctctgaaagaagcgatg
gagcctgagttcaaaacttaccagcagcaggtcgctaaaaacgctaaagcgatggtagaa
gtgttcctggaacgcggctacaaagtggtttccggcggcactgataaccacctgttcctg
gttgatctggttgataaaaacctgaccggtaaagaagcagacgccgctctgggccgtgct
aacatcaccgtcaacaaaaacagcgtaccgaacgatccgaagagcccgtttgtgacctcc
ggtattcgcgtgggtactccggcaattacgcgtcgcggcttcaaagaagcagaagcgaaa
gaactggctggctggatgtgtgacgtgctggacagcatcaatgatgaagccgttatcgag
cgcatcaaaggtaaagttctcgacatctgcgcacgttacccggtttacgcataa

DBGET integrated database retrieval system