KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_20360Help
Entry
O3O_20360         CDS       T02256                                 

Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00071  Fatty acid degradation
eso00280  Valine, leucine and isoleucine degradation
eso00310  Lysine degradation
eso00362  Benzoate degradation
eso00380  Tryptophan metabolism
eso00620  Pyruvate metabolism
eso00630  Glyoxylate and dicarboxylate metabolism
eso00640  Propanoate metabolism
eso00650  Butanoate metabolism
eso00900  Terpenoid backbone biosynthesis
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
eso01212  Fatty acid metabolism
eso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3O_20360
   00630 Glyoxylate and dicarboxylate metabolism
    O3O_20360
   00640 Propanoate metabolism
    O3O_20360
   00650 Butanoate metabolism
    O3O_20360
  09103 Lipid metabolism
   00071 Fatty acid degradation
    O3O_20360
   00072 Synthesis and degradation of ketone bodies
    O3O_20360
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O3O_20360
   00310 Lysine degradation
    O3O_20360
   00380 Tryptophan metabolism
    O3O_20360
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    O3O_20360
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O3O_20360
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_20360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eso04147]
    O3O_20360
Enzymes [BR:eso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     O3O_20360
Exosome [BR:eso04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O3O_20360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: AFS87796
Position
1073298..1074479
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGRSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMTQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgcggtgcg
ttagcgggtcgttccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtctgcctaatagcgtttct
gcaatcacgattaatgacgtctgcggttccggacttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgccggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgcacagcttggcaatagccagctggtt
gacagtcttgtgcatgatgggttatgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcaattgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgacccaaagtaacggtcagacgttggttgttgataccgatgaacagccacgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgacagcgggtaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcattcgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggtgcgatcgcacttggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaaggactggcaacgctttgtatcggc
gggggccagggtgtggcattgaccattgaacgtgacgaatag

DBGET integrated database retrieval system