KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_20810Help
Entry
O3O_20810         CDS       T02256                                 

Gene name
pgk
Definition
(GenBank) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
eso01230  Biosynthesis of amino acids
Module
eso_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eso_M00002  Glycolysis, core module involving three-carbon compounds
eso_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
eso_M00552  D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_20810 (pgk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eso04147]
    O3O_20810 (pgk)
Enzymes [BR:eso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     O3O_20810 (pgk)
Exosome [BR:eso04147]
 Exosomal proteins
  Proteins found in most exosomes
   O3O_20810 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-ProteinID: AFS87882
Structure
PDB: 

Position
979254..980417
Genome map
AA seq 387 aa AA seqDB search
MSVIKMTDLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHL
GRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDGVDVAEGELVVLENVRFNKGEKK
DDETLSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDALGKALKE
PARPMVAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFIAAQGHDVGKSLYEADLVD
EAKRLLTTCNIPVPSDVRVATEFSETAPATLKSVNDVKADEQILDIGDASAQELAEILKN
AKTILWNGPVGVFEFPNFRKGTEIVANAIADSEAFSIAGGGDTLAAIDLFGIADKISYIS
TGGGAFLEFVEGKVLPAVAMLEERAKK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaattaagatgaccgatctggatcttgctgggaaacgtgtatttatccgtgcg
gatctgaacgtaccagtaaaagacgggaaagtaaccagcgacgcgcgtatccgtgcttct
ctgccgaccatcgaactggccctgaaacaaggcgcaaaagtgatggtaacttcccacctg
ggtcgtcctaccgaaggcgagtacaacgaagaattctctctgctgccggttgttaactac
ctgaaagacaaactgtctaacccggttcgtctggttaaagattacctcgacggcgttgac
gttgctgaaggtgaactggttgttctggaaaacgttcgcttcaacaaaggcgagaagaaa
gacgacgaaaccctgtccaaaaaatacgctgcactgtgtgacgtgttcgtaatggacgca
ttcggtactgctcaccgcgcgcaggcttctactcacggtatcggtaaattcgctgacgtt
gcgtgcgcaggcccgctgctggcagctgaactggacgcgctgggtaaagcactgaaagaa
cctgctcgcccgatggtggctatcgttggtggttctaaagtatctaccaaactgaccgtt
ctggactccctgtctaaaatcgctgaccagctgattgttggtggtggtatcgctaacacc
tttatcgcggcacaaggccacgatgtgggtaaatccctgtacgaagctgacctggttgac
gaagctaaacgtctgctgaccacctgcaacatcccggttccgtctgatgttcgcgtagca
accgagttctctgaaactgcaccggctaccctgaaatctgttaacgatgtgaaagctgac
gagcagatcctggatatcggtgatgcttccgctcaggaactggctgaaatcctgaagaat
gcgaaaaccattctgtggaacggtccggttggcgtgttcgaattcccgaacttccgcaaa
ggtactgaaatcgtggctaacgctatcgcagacagcgaagcgttctccatcgctggcggc
ggcgacactctggcagcaatcgacctgttcggcattgctgacaaaatctcctacatctcc
actggcggcggcgcattcctcgaattcgtggaaggtaaagtactgcctgcagtagcgatg
ctcgaagagcgcgctaagaagtaa

DBGET integrated database retrieval system