KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_21265
Entry
O3O_21265         CDS       T02256                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
Brite
KEGG Orthology (KO) [BR:eso00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eso02044]
    O3O_21265
Secretion system [BR:eso02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3O_21265
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AFS87972
Position
884680..886011
AA seq 443 aa
MNLDVFDGANFSLDFVRFYLNGPATVTGIIYTLLCDEVDNIVLQRNNDVLYDISANISGA
GFYESEVTLPQKGNVSYIHNLILDYFSFPERFNFIDIEFDSGIELCSGDSVRIEITLKSS
AEKYEPDRIERNVSERLFKVNCSPVVNLFEKKTEPLRLSDGQDEYQVNTDLYSRNEVLIW
DINKVTLHRYENDIVKQFPLKNLFGLEHSVIKQSCNIFWHSSCYRSSSERGNFEESVYIR
LSDDGGAQSCIMTGDVLSIDAICTNGNIPSSINNGDPDGDFDCDIDIAQLRITALNRPSR
MLPAMALKGMNWRIVSQLSLNFVLLSGTDGAMKLREMLSIYNYNNNHSISIFIEWIKELQ
ITPVSSRLPGIYPPVTARGIDITVTLSKDADMHPECFMFCSFLDHFLGLHAPVNSFTRMI
TVIEHEEHTRRVWPIRAGKLTWL
NT seq 1332 nt   +upstreamnt  +downstreamnt
ttgaatttagacgttttcgacggagctaatttttctcttgattttgtaagattttatttg
aatggtccggcaacggttactggtataatatatacattattgtgcgatgaggtcgataat
atcgttttgcagagaaataatgatgtgttatatgatatcagtgctaatatatccggtgcc
ggattttatgagagtgaagtaacacttccacaaaaagggaacgtttcttatatacataac
ctcatactggactatttttcttttccagaacgatttaacttcattgatatagaatttgac
tccggaatcgaattatgctcaggggattctgtgagaatagaaataacattaaaaagcagt
gcagaaaagtatgagccagacagaatagaaaggaatgtttctgaaagactttttaaagta
aactgttctcccgttgtcaatctcttcgagaagaaaactgaacccctacgattatctgat
ggccaggatgagtatcaggtaaataccgatttatattcacgtaatgaagtcttaatctgg
gatataaataaagtgacattgcacagatatgaaaatgatatagtcaagcagtttccgtta
aaaaatttatttggacttgaacattctgtcattaaacaatcgtgcaatatattctggcat
agttcatgttatcgctcgtcttctgaaagagggaactttgaggaaagtgtatatattcgt
ctgagcgatgatggcggagcccagtcatgtatcatgactggggatgtcctttcaattgat
gcaatatgtacaaatggtaatattccatcatcaattaataatggtgatcctgatggtgat
tttgattgtgatatagatattgctcagctgcgaataactgcgctgaaccgtccatcaaga
atgttgccggctatggcattaaaaggaatgaactggagaattgtttctcagttatccctt
aattttgtgttgctcagtggtactgatggggcaatgaaactgagagaaatgctatccata
tataactacaacaataaccactcaatatcaatttttattgaatggattaaagagttacaa
atcacaccagtttcatcccgtttacccggcatatatccgcctgtaactgctcgtggaatt
gatattaccgtaactctttcaaaggatgcagatatgcaccctgaatgtttcatgttttgc
tctttccttgatcactttcttgggctacatgcccctgtcaatagctttactcgcatgatt
actgtcattgaacatgaggagcacactcgtcgtgtatggccgataagagcaggaaagtta
acatggctttga

DBGET integrated database retrieval system