KEGG   Escherichia coli O104 H4 2009EL-2071 (EAEC): O3O_21280
Entry
O3O_21280         CDS       T02256                                 

Definition
(GenBank) hypothetical protein
Organism
eso  Escherichia coli O104:H4 2009EL-2071 (EAEC)
SSDB
Other DBs
NCBI-ProteinID: AFS87975
Position
883278..883784
AA seq 168 aa
MVGVMSNSSALSREFVKIEIGGKVIKGNSKVENSGDYFDGHCPQAFHAFSGIDGTVFDLI
NLKLRVTKHIQDLLENFFKRGEKEVKIEILRRESTKSGSAYSSFKVVYQGCRMHNMLLAH
DNDSNLILELSFTPEESVSIEMNIPSDDGKSTEKLGPMTYNLYKEALV
NT seq 507 nt   +upstreamnt  +downstreamnt
atggtcggagttatgagtaattcttccgctcttagcagggagtttgtcaaaatagagata
ggtggaaaagttataaagggaaattcaaaagttgaaaacagtggtgactactttgatgga
cattgtcctcaggcatttcacgctttttcaggaattgacggtactgtttttgatttaatt
aatttgaagcttagggttactaaacacatacaagaccttctggagaacttttttaagaga
ggtgaaaaagaagttaaaatagaaattttacgtagggaatcaactaaatcaggtagtgca
tactcatcatttaaggttgtttatcaggggtgtcgtatgcataatatgttgttggctcat
gataatgattcaaatctcattctggaattgtcgtttaccccagaagagagtgtctcaatt
gagatgaatattccgtcagatgatggaaaaagtacggagaaattgggaccaatgacgtac
aacttatataaagaggctcttgtataa

DBGET integrated database retrieval system