KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_21830Help
Entry
O3O_21830         CDS       T02256                                 

Definition
(GenBank) sensor protein QseC
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso02020  Two-component system
eso02024  Quorum sensing
Module
eso_M00453  QseC-QseB (quorum sensing) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:eso00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3O_21830
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    O3O_21830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eso01001]
    O3O_21830
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eso02022]
    O3O_21830
Enzymes [BR:eso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     O3O_21830
Protein kinases [BR:eso01001]
 Histidine kinases
  OmpR family
   O3O_21830
Two-component system [BR:eso02022]
 OmpR family
  QseC-QseB [MD:M00453]
   O3O_21830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA 2CSK_N HAMP HATPase_c_5 Y_Y_Y
Motif
Other DBs
NCBI-ProteinID: AFS88081
Structure
PDB: 

Position
complement(774761..776110)
Genome map
AA seq 449 aa AA seqDB search
MKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNVDELFDTQLMLFAKRLSTLDL
NEINAADRMAQTPNKLKHGHVDDDALTFAIFTHDGRMVLNDGDNGEDIPYSYQREGFADG
QLVGDKDQWRFVWMTSPDGKYRIVVGQEWEYREDMALAIVAGQLIPWLVALPIMLIIMMV
LLGRELAPLNKLALALRMRDPDSEKPLNATGVPSEVRPLVESLNQLFARTHAMMVRERRF
TSDAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHYGIDRATRLVDQLLTLSRLD
SLDNLQDVAEIPLEDLLQSSVMDIYHTAQQAKIDVRLTLNAHGIKRTGQPLLLSLLVRNL
LDNAVRYSPQGSVIDVTLNADNFIVRDNGPGVTPEALARIGERFYRPPGQTATGSGLGLS
IVQRIAKLHGMNVEFGNAEQGGFEAKVSW
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttacccaacgtcttagtctgcgcgtcaggctgacgctaatctttttaattctg
gcctcggtgacctggctgctttccagctttgtcgcctggaaacaaacaacggataacgtc
gatgaattgttcgacacccaactgatgctgtttgccaagcggttaagtacgctcgatctc
aacgaaatcaacgcggcggatcgcatggcacagacgccaaataaattaaaacacggtcat
gttgatgacgatgcgctgacctttgccatctttacccacgacggcagaatggtccttaac
gatggcgataacggagaagatattccttatagctatcaacgggaaggttttgctgacggg
caactggtgggcgataaagatcaatggcgttttgtctggatgacctcacctgatggcaaa
tatcgcatcgttgttggtcaggaatgggaataccgtgaagacatggcgctggcgattgtt
gccgggcaattgatcccgtggctggtcgcactgccgattatgttaatcatcatgatggta
ctattgggtcgtgaactcgcgccgctgaacaaactggcgctggcgctgcgtatgcgtgac
cctgactcggaaaaaccactaaacgcgactggcgtacccagcgaagtgcgtccgttggtt
gagtcgctaaatcaactgttcgcccgcacacatgcgatgatggttcgtgaacgacgcttt
acctccgacgcagctcacgaactacgtagcccgttaacggcgctgaaagtgcaaaccgaa
gttgcgcagctttctgacgatgatccgcaagcgcggaaaaaagcgctgcttcaattacat
tacgggatcgatcgcgctactcgtctggttgatcaactgctcactctatcgcggctggac
tcactggataaccttcaggacgtcgcggagatcccgcttgaagatctcctccaatcgtcg
gtgatggatatttaccacacggcgcagcaggcgaaaattgacgtgcgactgacactcaat
gcccacggcatcaaacgcaccggacaaccgctattgctaagtttgttggtgcgaaatttg
ctggataacgccgtgcgctacagtccacagggcagcgtgatagacgtcacgctgaatgct
gataatttcatcgtgagggataacggccccggtgtgacgccagaggctctggcgcgaatt
ggcgaacgcttctatcgcccccccggacaaaccgctaccggcagtggacttgggctatcg
attgtccagcgaatcgccaaattgcatggcatgaatgttgagtttgggaatgcggaacaa
ggtggatttgaggcgaaggtaagctggtaa

DBGET integrated database retrieval system