KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_23595Help
Entry
O3O_23595         CDS       T02256                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso00020  Citrate cycle (TCA cycle)
eso00620  Pyruvate metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
Module
eso_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_23595
   00020 Citrate cycle (TCA cycle)
    O3O_23595
   00620 Pyruvate metabolism
    O3O_23595
Enzymes [BR:eso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     O3O_23595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AFS88434
Structure
PDB: 

Position
complement(427457..429079)
Genome map
AA seq 540 aa AA seqDB search
MRVNNGLTPQELEAYGISDVHDIVYNPSYDLLYQEELDPSLTGYERGVLTNLGAVAVDTG
IFTGRSPKDKYIVRDDTTRDTFWWADKGKGKNDNKPLSPETWQHLKGLVTRQLSGKRLFV
VDAFCGANPDTRLSVRFITEVAWQAHFVKNMFIRPSDEELAGFKPDFIVMNGAKCTNPQW
KEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLLPLKGIASMHCSANVGEK
GDVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPEI
YNAIRRDALLENVTVREDGTIDFDDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFL
TADAFGVLPPVSRLTADQTQYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTQ
YAEVLVKRMQAAGAQAYLVNTGWNGTGKRISIKDTRAIIDAILNGSLDNAETFTLPMFNL
AIPTELPGVDTKILDPRNTYASPEQWQEKAETLAKLFIDNFDKYTDTPAGAALVAAGPKL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaacaatggtttgaccccgcaagaactcgaggcttatggtatcagtgacgta
catgatatcgtttacaacccaagctacgacctgctgtatcaggaagagctcgatccgagc
ctgacaggttatgagcgcggggtgttaactaatctgggtgccgttgccgtcgataccggg
atcttcaccggtcgttcaccaaaagataagtatatcgtccgtgacgataccactcgcgat
actttctggtgggcagacaaaggcaaaggtaaaaacgacaacaaacctctctctccggaa
acctggcagcatctgaaaggcctggtgaccaggcagctttccggcaaacgtctgttcgtt
gtcgacgctttctgtggtgcgaacccggatactcgtctttccgtccgtttcatcaccgaa
gtggcctggcaggcgcattttgtcaaaaacatgtttattcgcccgagcgatgaagagctg
gcaggtttcaaaccagactttatcgttatgaacggcgcgaagtgcactaacccgcagtgg
aaagaacagggtctgaactccgaaaacttcgtggcgtttaacctgaccgagcgcatgcag
ctgattggcggcacctggtacggcggcgaaatgaagaaagggatgttctcgatgatgaac
tacctgctgccgctgaaaggtatcgcttctatgcactgctccgccaacgttggtgagaaa
ggcgatgttgcggtgttcttcggcctttccggcaccggtaaaaccaccctttccaccgac
ccgaaacgtcgcctgattggtgatgacgagcacggctgggacgatgacggcgtgtttaac
ttcgaaggcggctgctacgcaaaaactatcaagctgtcgaaagaagcggaacctgaaatc
tacaacgctatccgtcgcgatgcgctgctggaaaacgtcaccgtgcgtgaagatggcact
atcgactttgatgatggttcaaaaaccgagaacacccgcgtttcttatccgatctatcac
atcgataacattgttaagccggtttccaaagcgggccacgcgactaaggttatcttcctg
actgctgatgctttcggcgtgttgccgccggtttctcgcctgactgccgatcaaacccag
tatcacttcctctctggcttcaccgccaaactggccggtactgagcgtggcatcaccgaa
ccgacgccaaccttctccgcttgcttcggcgcggcgttcctgtcgctgcacccgactcag
tacgcagaagtgctggtgaaacgtatgcaggcggcgggcgcgcaggcttatctggttaac
actggctggaacggcactggcaaacgtatctcgattaaagatacccgcgccattatcgac
gccatcctcaacggttcgctggataacgcagaaactttcactctgccgatgtttaacctg
gcgatcccaaccgaactgccgggcgtagacacgaagatcctcgatccgcgtaacacctac
gcttccccggaacagtggcaggaaaaagccgaaaccctggcgaaactgtttatcgacaac
ttcgataaatacactgacaccccagcgggtgctgcgctggtagcggcaggtccgaagctg
taa

DBGET integrated database retrieval system