KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_24765Help
Entry
O3O_24765         CDS       T02256                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso00620  Pyruvate metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_24765
   00620 Pyruvate metabolism
    O3O_24765
Enzymes [BR:eso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     O3O_24765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFS88662
Position
169862..171400
Genome map
AA seq 512 aa AA seqDB search
MTNNPPSAQIKPGEYGFPLKLKARYDNFIGGEWVAPADGEYYQNLTPVTGQLLCEVASSG
KRDIDLALDAAHKVKDKWAHTSVQDRAAILFKIADRMEQNLELLATAETWDNGKPIRETS
AADVPLAIDHFRYFASCIRAQEGGISEVDSETVAYHFHEPLGVVGQIIPWNFPLLMASWK
MAPALAAGNCVVLKPARLTPLSVLLLMEIVGDLLPPGVVNVVNGAGGEIGEYLATSKRIA
KVAFTGSTEVGQQIMQYATQNIIPVTLELGGKSPNIFFADVMDEEDAFFDKALEGFALFA
FNQGEVCTCPSRALVQESIYERFMERAIRRVESIRSGNPLDSVTQMGAQVSHGQLETILN
YIDIGKKEGADVLTGGRRKLLEGELKDGYYLEPTILFGQNNMRVFQEEIFGPVLAVTTFK
TMEEALELANDTQYGLGAGVWSRNGNLAYKMGRGIQAGRVWTNCYHAYPAHAAFGGYKQS
GIGRETHKMMLEHYQQTKCLLVSYSDKPLGLF
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataatcccccttcagcacagattaagcccggcgagtatggtttccccctcaag
ttaaaagcccgctatgacaactttattggcggcgaatgggtagcccctgccgacggcgag
tattaccagaatctgacgccggtgaccgggcagctgctgtgcgaagtggcgtcttcgggc
aaacgagacatcgatctggcgctggatgctgcgcacaaagtgaaagataaatgggcgcac
acctcggtgcaggatcgcgcggcgattctgtttaagattgccgatcgaatggaacaaaac
ctcgagctgttagcgacagctgaaacctgggataacggcaaacccattcgcgaaaccagt
gctgcggatgtaccgctggcgattgaccatttccgctatttcgcctcgtgtattcgggcg
caggaaggtgggatcagtgaagttgatagcgaaaccgtggcctatcatttccatgaaccg
ttaggcgtggtggggcagattatcccgtggaacttcccgctgctgatggcgagctggaaa
atggctcccgcgctggcggcgggcaactgtgtggtgctgaaacccgcacgtcttaccccg
ctttctgtactgctgctaatggaaatcgtcggtgatttactgccgccgggcgtggtgaac
gtggtcaacggcgcaggtggggaaattggcgaatatctggcgacctcgaaacgcatcgcc
aaagtggcgtttaccggctcaacggaagtgggccaacaaattatgcaatacgccacgcaa
aacattattccggtgacgctggagctgggcggcaaatcgccaaatatcttctttgctgat
gtgatggatgaagaagatgcctttttcgataaagcgctggaaggctttgcactgtttgcc
tttaaccagggtgaagtttgcacctgtccgagtcgtgccttagtgcaggagtcaatctac
gaacgctttatggaacgcgccatccgccgtgtcgaaagcattcgcagcggtaacccactc
gacagcgtgacgcaaatgggcgcgcaggtttctcacgggcaactggaaaccatcctcaac
tacattgatatcggtaaaaaagagggcgcagacgtgctcaccggcgggcggcgcaagctg
ctggaaggtgaactgaaagacggctactacctcgaaccgacgattctgtttggtcagaac
aatatgcgggtgttccaggaggagatttttggcccggtgctggcggtgaccaccttcaaa
acgatggaagaagcgctggagctggcgaacgatacgcaatatggcctgggcgcgggcgtc
tggagccgcaacggtaatctggcctataagatggggcgcggcatacaggctgggcgcgtg
tggaccaactgttatcacgcttacccggcacatgctgcgtttggtggctacaaacaatca
ggtatcggtcgcgaaacccacaagatgatgctggagcattaccagcaaaccaagtgcctg
ctggtgagctactcggataaaccgttggggctgttctga

DBGET integrated database retrieval system