KEGG   Eubacterium siraeum V10Sc8a: ES1_01440Help
Entry
ES1_01440         CDS       T02589                                 

Definition
(GenBank) Glycerol dehydrogenase and related enzymes
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
esr00561  Glycerolipid metabolism
esr00640  Propanoate metabolism
esr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ES1_01440
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    ES1_01440
Enzymes [BR:esr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     ES1_01440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: CBL33345
UniProt: D4MHW2
Position
136835..137929
Genome map
AA seq 364 aa AA seqDB search
MGRLRAMREPLKYVQGRDALLKFHEEMGYMGKRWLFVCSNSGYKACHDKIEKSFGDLDDY
RRYEVFGGISSNGEINKMKAIVEADNIDTVVAVGGGSAVDTAKATAYYSGKHIVIVPTVA
ATDAPCTGLSVIYNDDHSFDKYLFYPTNPDAVMVDTTVIANAPVKFLIAGMGDALGTYFE
GRASIRTESASLEGTGITRAGQALARLCYDTLREYGKQAIEACKVHAVTPALENIVEANV
YLSGVGADNVNCAAAHSFYNGVTSLGIKHADHGCCVALGTLVQLVLEGAPKEEFKEVQDF
CLEVGLPVTLEEIGVTTPEQVKTISENACIPGETIHNLAGDVQPVELYDAIMQADAMGKI
ALGK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggaagactcagagcgatgcgtgagccgctcaaatatgtacagggcagagatgcactg
cttaaatttcacgaagaaatgggttatatgggcaagcgctggctgtttgtatgctcaaac
agcggctacaaagcctgtcatgataagatagaaaagagcttcggcgaccttgacgattac
agacgttatgaggtttttggcggcatttccagcaacggcgagataaacaaaatgaaagcc
atcgttgaagccgacaatattgatactgttgtcgcagtcggtggtggaagcgcagtagat
accgcaaaggcaactgcgtattacagcggaaaacacattgtaatcgtgcctacagttgcg
gctacagacgctccttgcacgggactttccgtaatttacaacgatgaccacagcttcgat
aaatatctgttctacccgacaaatcctgacgctgtaatggtcgacacgaccgttatcgca
aatgcgcctgtcaagttccttatcgcaggtatgggtgatgcgctcggcacatatttcgag
ggtcgtgcttctatccgcactgaatccgcaagccttgagggtacgggcatcacaagagca
ggtcaggcgcttgctcgtctttgctatgacacgctccgtgaatacggcaagcaggctatc
gaggcttgtaaggtacacgccgttactcccgcacttgaaaatatcgttgaagctaacgtt
tacctttcaggtgtcggcgccgataacgtaaactgtgccgccgctcactcattctacaac
ggcgttacttctctcggcataaagcacgcagatcacggctgctgcgttgcacttggcacg
cttgtacagcttgtgcttgagggtgcgcctaaagaggagttcaaggaagttcaggacttc
tgccttgaggtcggtcttcccgtaacgcttgaagaaatcggcgttacaactcctgagcag
gtaaagactatttccgagaacgcttgtatccccggcgaaactatccacaacctcgcaggc
gatgtacagcccgttgaactgtatgacgctattatgcaggctgacgctatgggtaagatt
gcactcggcaaataa

DBGET integrated database retrieval system