KEGG   Enterococcus silesiacus: ATZ33_05765Help
Entry
ATZ33_05765       CDS       T04218                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
ess  Enterococcus silesiacus
Pathway
ess00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ess00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ATZ33_05765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ess01007]
    ATZ33_05765
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ess03016]
    ATZ33_05765
   03029 Mitochondrial biogenesis [BR:ess03029]
    ATZ33_05765
Enzymes [BR:ess01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     ATZ33_05765
Amino acid related enzymes [BR:ess01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   ATZ33_05765
Transfer RNA biogenesis [BR:ess03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ATZ33_05765
 Prokaryotic type
   Other AARSs
    ATZ33_05765
Mitochondrial biogenesis [BR:ess03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ATZ33_05765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N AvrM-A Syd
Motif
Other DBs
NCBI-ProteinID: ALS00892
UniProt: A0A0S3K9E1
Position
complement(1250606..1252297)
Genome map
AA seq 563 aa AA seqDB search
MNNKEIVAKAIFEVVKEDLSLETVTQLLENPKSVDHGDVAFPAFSLAKVYRKAPQQIAAD
LAEKIAGTDFEKIEVVGPYLNFFMNKKMVSQAVIGQIAKEKGHYGDSSIGGKGNVPIDMS
SPNIAKPISMGHLRSTVIGNSIAFILEKIGYTPIRINHLGDWGTQFGKLIVGYKKWGSEE
AVKTAPITELLRLYVQFHEEAETQPELEEEARAWFKKLEEGDVEATELWQWFRTESLKEF
DKIYSMLEVSFDSYNGEAFYNDKMDEIVTMLEEKHLLQENQGAEIVDLSAYELNPALIKK
SDGATLYITRDLAAAVYRKRNYDFAKSIYVVGNEQSNHFKQLKAVLNELGFDWSKDMHHV
PFGLITQGGKKLSTRKGKIVLLEEVLNEAVELANNQIMEKNPDLPDREEVARQVGIGSVI
FHDLKNDRLNNFDFVLEEVVRFEGETGPYVQYTHARAMSILRKANFTIDETKEYALDDKE
SWEVVKLLQKFPDIVLQAAEKYEPSVIAKHAIQVAQAFNKYYAHVKILAEDEQKESRLAL
VYAMATIIKEDLRLLGLHAPNEM
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaagaaatcgtagcaaaagccattttcgaagtggtaaaagaggacctatct
ttagaaaccgttacacaattattggaaaatcctaaatctgtcgatcacggcgatgtagct
tttccagccttctcattagctaaagtataccgtaaagcgccacagcaaatcgccgctgat
ttagctgaaaaaatcgctggaactgactttgaaaaaatcgaagtagttgggccttacttg
aactttttcatgaataaaaaaatggtcagtcaagcagtgattggtcaaattgctaaagaa
aaagggcattatggcgatagctccattggcggaaaaggcaatgtcccaatcgatatgtct
tcacctaatattgcaaaaccaatttcaatggggcatctacgttcaacggtaattgggaat
tctattgcttttatccttgaaaaaattggttacacaccgatccgcatcaaccatttaggt
gattggggcacacagtttggtaaattgattgtgggctataaaaaatggggttcagaagaa
gccgttaaaacggcaccaattactgaattattacgtttatacgtacaatttcatgaagaa
gccgaaacacaacctgaattggaagaagaagctcgtgcttggtttaaaaaactagaagaa
ggcgacgtagaagcaactgaattatggcaatggttccgtacagaatcattaaaagaattc
gataaaatctattccatgttggaagtttcatttgattcatacaatggagaagcgttctac
aacgataaaatggatgaaatcgtaacaatgctagaagaaaaacatttactgcaagaaaat
caaggggctgaaatcgtcgatttatctgcatatgagctaaatcctgccttgatcaaaaaa
tcagatggtgccactctttatatcacacgtgatttagcggctgctgtttatcgtaaacgt
aactatgatttcgcaaaatcaatctatgttgtcggtaatgaacaaagtaaccacttcaaa
caattaaaagctgttttaaatgaacttggatttgattggtcgaaagacatgcaccatgtt
ccgtttggtttgatcacacaaggtggtaaaaaactatcgacacgtaaaggaaaaattgtt
ttacttgaagaggtactgaatgaagccgttgaattagctaataatcaaattatggaaaaa
aatcctgatttaccagatcgtgaagaagtcgcaagacaagttgggatcggctctgttatt
ttccatgatcttaaaaatgatcggttgaataattttgatttcgtgttggaagaagttgtg
cgttttgaaggagagacaggcccgtatgttcaatatacgcacgctcgtgcgatgagtatt
ttaagaaaagcaaactttaccatcgatgaaacaaaagagtatgcgctagatgataaagaa
agttgggaagtcgttaaattattacaaaaattcccagatattgtcttgcaagcagcagaa
aaatatgagccttctgtgattgcaaaacatgcgatccaagttgcccaagccttcaataaa
tactatgctcatgttaagatcttagcagaagatgagcaaaaagaatcacgtttagcttta
gtttatgcaatggcaacaattattaaagaagatttacgtctgttaggtttacatgcacca
aatgaaatgtaa

DBGET integrated database retrieval system