KEGG   Enterococcus silesiacus: ATZ33_07560Help
Entry
ATZ33_07560       CDS       T04218                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ess  Enterococcus silesiacus
Pathway
ess03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ess00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    ATZ33_07560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ess03400]
    ATZ33_07560
Enzymes [BR:ess01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ATZ33_07560
DNA repair and recombination proteins [BR:ess03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ATZ33_07560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 AAA_11 HHH_5 Viral_helicase1 T2SSE HHH_8 UvrD_C DUF2075 TBPIP Pyr_excise AAA_28 NTPase_1 AAA AAA_12 AAA_22 CPT AAA_18 Zeta_toxin UvrD-helicase HTH_IclR IMS_HHH
Motif
Other DBs
NCBI-ProteinID: ALS01229
UniProt: A0A0S3KA84
Position
complement(1645990..1648566)
Genome map
AA seq 858 aa AA seqDB search
MDTLFGEGEKEYVVGQVQAIFFQNPSNFYKVLLVKITDTNTDYLEKEIVTTGSFGQIQEE
EIYRFFGHFVDHPRYGKQFQVDSYQQERPTSASGVVNYLSSEKFPGIGKRTAEKIVEILG
EDAIDRIIETPDVLEKVPQLNEKKRQTIIETIRLNHGMEQVIVGLNRYGFGSQLSFAIYQ
TYKEETLDIIHENPYQLVEDIEGIGFKRADNIAEQLGIGADSDKRVRAAITHEIFQHSVR
SGNTYVEAEMLLRETINTLEASRPVEISIDQVAEQIIHLVEEAKIQQEGTKLFENSLYFS
EWGIGTSIQRLLTRKKEIKYDKKDIEKNIRGVEKRLGILYGDSQQAAIEEAIKSPLFILT
GGPGTGKTTVINGIVSVFAELNGLSLDVKDYTQEMFPILLAAPTGRAAKRMNETTGLPAS
TIHRLLGLSGREKNPSMTAKELEGGLLIVDEMSMVDTWLANTLFKAIPTNMQVIFVGDKD
QLPSVGPGQVLHDLMQINEIPQRELTEIYRQGDGSSIIPLAHEIKQGKLPQDFTVNQKDR
SFFPSDVYHIETYVRQIVTKAKAKGFSPQDIQLLAPMYRGAAGIDALNKMMQEIFNPNDG
TKKEVKWNESVYRIGDKVLHLVNTPELNVFNGDMGEIVGIILAKESEDKVDELVIQFDNN
EVSYKRNEWNKITLSYCCSIHKAQGSEFKMVILPMVHQYHRMLQRNLLYTAVTRSKDILI
LLGEVQAFNTCVAHESASRLTMLKERITSADDMSLTTRMQLEAYEEGLNKEGPFSETTEI
KSVTYEAVKEETAVVEEVIVPVRTKPKTEEISLFSEPVQETSEQIEAEVERLLTPSLVSA
QTIDPMIGMGQTTPADFM
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggatacattgtttggcgaaggggaaaaagaatatgtggttggacaagttcaggcaatc
ttttttcaaaatcccagcaatttttataaagttttgttggtgaaaatcacggatacgaat
acagattatttagaaaaagaaatcgtaacgactggtagtttcggtcaaattcaggaagaa
gaaatttatcgcttttttggacatttcgttgatcatcctcgttatggcaaacaatttcaa
gtcgatagctatcagcaagagcgaccaacttctgccagtggcgttgtaaattatctttct
agtgaaaaatttccagggatagggaagcgaacagctgagaaaatcgttgaaattttggga
gaagatgcaatcgatcgtattattgaaactcctgatgttcttgaaaaagttcctcaacta
aatgaaaaaaaacgccaaacaatcattgaaacgatccgtttaaatcatgggatggagcaa
gtaatcgtcggcttaaatcgttacggtttcgggagtcagctttcgtttgcaatttatcaa
acttataaagaagaaactttagatattattcacgaaaatccatatcaattagttgaagat
attgaagggattggctttaaacgggccgataatattgcagagcagttggggattggtgca
gattcagacaaacgagtgcgagcggcgatcacacatgaaattttccaacattctgtgcgt
tctgggaatacttatgtggaagcagaaatgttgctgagagaaacgatcaatacattggaa
gcgagtcgacctgtagaaatttccattgatcaagtggcagaacagatcatccatttagta
gaagaagctaaaatccagcaagaaggcacaaaactttttgaaaatagtttatatttttca
gaatggggaatcgggacatcgatccaacgtctgctaacacgaaaaaaagaaattaagtat
gataaaaaagacattgaaaaaaatattcgtggggttgaaaaacgcttgggaatcttgtat
ggcgattctcaacaagcggcaattgaagaagcaatcaaatcaccattattcattttaact
ggcggaccaggtactgggaaaacgaccgtcatcaacggaattgtttcagtctttgccgag
ctgaatggactttctttagatgtaaaggattatacacaggaaatgtttccaatactatta
gccgctccaactggacgtgcagcgaaacgaatgaatgaaacgactggactgccggcaagt
acgatccatcgtctcttggggttaagtggacgagaaaaaaatcctagtatgacagctaaa
gaactagaaggcggtttattgatcgttgatgaaatgtcgatggtcgatacttggttggca
aatacattgtttaaagctattccaaccaatatgcaggtgatttttgttggtgataaggat
caattaccttctgttggaccgggtcaggttctgcatgatttgatgcaaatcaatgaaatt
ccacaaagagaattaacagaaatttatcgacaaggcgacggttcaagtattattccctta
gctcatgaaatcaagcagggaaaattaccacaagattttactgtcaatcaaaaagaccgt
tcattttttccaagtgacgtctatcatatcgagacctatgtccgccaaatcgtaacaaaa
gctaaagcaaagggcttttctccgcaagatatccaattactggctccaatgtaccgagga
gctgctgggattgatgcgttaaacaaaatgatgcaagaaatttttaatcctaatgacggc
acgaaaaaggaagtaaaatggaatgaatctgtttatcgcattggagataaggtcttacat
ttagtcaatacaccagagctgaatgtgtttaatggtgacatgggcgagatagtaggaatt
attttagcgaaagaatcagaagataaagtggatgaattagtgattcagtttgacaataat
gaagtcagctataaacgcaatgagtggaataaaatcacgctctcctattgctgttcgatt
cataaagcgcaaggtagcgagtttaaaatggttattttgccgatggtgcatcaatatcat
cggatgctgcagcgtaatttgctctataccgcagtgactagaagcaaggacatcctgatc
ctgttaggtgaagttcaagcctttaacacttgtgttgcgcatgaatcagctagtcgctta
acgatgctcaaagaacggatcactagtgcggatgacatgtcgttaactacgagaatgcaa
cttgaggcctatgaagaaggattaaacaaagaggggccattttcagaaacaacagaaatt
aaatcagtgacctatgaagctgtcaaagaggagactgctgtagtcgaagaagtgatagtg
ccagtgagaactaaacctaaaacggaagaaatctcactgtttagtgaacctgttcaagaa
acgagtgaacaaatagaagcagaggttgagcgcttattgacgccaagcttagtcagtgcg
caaacaattgacccaatgatcggaatggggcagacaacgccagctgattttatgtag

DBGET integrated database retrieval system