KEGG   Enterococcus silesiacus: ATZ33_10610Help
Entry
ATZ33_10610       CDS       T04218                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ess  Enterococcus silesiacus
Pathway
ess00071  Fatty acid degradation
ess00072  Synthesis and degradation of ketone bodies
ess00280  Valine, leucine and isoleucine degradation
ess00310  Lysine degradation
ess00362  Benzoate degradation
ess00380  Tryptophan metabolism
ess00620  Pyruvate metabolism
ess00630  Glyoxylate and dicarboxylate metabolism
ess00640  Propanoate metabolism
ess00650  Butanoate metabolism
ess00900  Terpenoid backbone biosynthesis
ess01100  Metabolic pathways
ess01110  Biosynthesis of secondary metabolites
ess01120  Microbial metabolism in diverse environments
ess01130  Biosynthesis of antibiotics
ess01200  Carbon metabolism
ess01212  Fatty acid metabolism
ess02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ess00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATZ33_10610
   00630 Glyoxylate and dicarboxylate metabolism
    ATZ33_10610
   00640 Propanoate metabolism
    ATZ33_10610
   00650 Butanoate metabolism
    ATZ33_10610
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ATZ33_10610
   00072 Synthesis and degradation of ketone bodies
    ATZ33_10610
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ATZ33_10610
   00310 Lysine degradation
    ATZ33_10610
   00380 Tryptophan metabolism
    ATZ33_10610
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ATZ33_10610
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ATZ33_10610
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ATZ33_10610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ess04147]
    ATZ33_10610
Enzymes [BR:ess01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ATZ33_10610
Exosome [BR:ess04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ATZ33_10610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALS01809
UniProt: A0A0S3KBW7
Position
complement(2287899..2289089)
Genome map
AA seq 396 aa AA seqDB search
MKEVVIVSAMRTPIGSFGGSLAQFSAVDLGVKVVERLIEKAGIEKELIEEVIIGNVLSAG
KGQNVARQIAVNAGIPFTVPASTVGNVCGSGLKAVINGAQAILSGDREVVLVGGSESMSQ
AGYVSSDSRWGLRMGHGQLTDTILSDGLTDAFSGIHMGITAENLAEQFNITREAQDAFAL
NSQEKALKAIEEHAFDEQIVPITIPRKKQEPFIMTADEGPRAGLSIEKLGQLKTVFKEQG
TVTAGNASGINDGAAMMLLMSKEKAELLGISYMATIKGYAFEGVDPAIMGYGPVVSTKKV
LQKTGLTIEAIDLIESNEAFAAQSLTVAKELNLDLEKTNIHGGAIALGHPIGASGARILT
TLLHGLNETQAKTGLATLCVGGGMGVSMIVERRESR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtcgtgatcgtatcggcaatgagaaccccgattgggagtttcggcggttca
cttgcacaattttcagcagttgatttaggtgttaaagtagtggaaagactcattgaaaaa
gcaggtattgaaaaagagttgattgaagaagtaattatcggcaatgttttatcggctggt
aaaggtcaaaatgtggcccggcaaattgccgtaaatgctggcattccttttactgttcct
gcatcaactgtgggcaatgtttgtggttccgggttaaaagctgtgatcaatggggctcaa
gccattttgtcaggggatcgggaagttgttttagttggtggtagtgaaagtatgagccaa
gcaggctatgtttcatcagacagccgttggggattgcgaatgggtcatggtcagttaacg
gatacgattttatctgatggtttgacggatgccttttctgggattcatatggggatcact
gctgagaatttagcggagcaattcaatattacacgagaagcacaagatgcatttgcttta
aacagtcaagaaaaagcgttgaaagctattgaggagcatgccttcgacgagcaaatcgtc
ccgatcacgattcctagaaaaaaacaggagccgtttatcatgacagctgatgaaggacct
cgagcaggtttgtctatcgaaaaattaggacaattgaagaccgtcttcaaagagcaaggg
acggttacggcaggaaatgcctccggtattaatgacggtgctgcgatgatgctcttaatg
agtaaagaaaaagcagaattactaggcatttcctatatggcaacgatcaaaggttatgca
tttgaaggggtggatccagcgatcatgggctatggtcctgtggtttcaacaaaaaaagtg
ctgcaaaaaacaggtctgacgattgaagcaattgatttaattgagtcaaacgaagcattt
gcggcacaatctttgactgtcgcaaaagaactaaatcttgatttggaaaaaaccaatatt
cacggtggagcaattgccttaggtcatccaatcggcgcttcaggagccagaattttgact
actttgttacatggattaaatgagactcaagcaaaaacaggcttggcgacactttgtgtt
ggcggcgggatgggtgtatcgatgatcgttgaaagaagggagtctagataa

DBGET integrated database retrieval system