KEGG   Enterococcus silesiacus: ATZ33_17065Help
Entry
ATZ33_17065       CDS       T04218                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
ess  Enterococcus silesiacus
Pathway
ess00670  One carbon pool by folate
ess01100  Metabolic pathways
ess01120  Microbial metabolism in diverse environments
ess01200  Carbon metabolism
Module
ess_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:ess00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ATZ33_17065
Enzymes [BR:ess01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     ATZ33_17065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ALS03027
UniProt: A0A0S3KFG1
Position
3719635..3721299
Genome map
AA seq 554 aa AA seqDB search
MVKTDIEIAQEAIMLPVTKVAEKLGLNEEQFELYGKYKAKIEVDKIKTNKEGKVILVTAI
TPTPAGEGKTTTVVGLGDALNRIGKDAIIALREPSLGPVFGIKGGAAGGGYAQVVPMEDI
NLHFTGDFHAIGAANNLLAAIIDNHIFQGNELGIDNRRITWKRAVDMNDRQLRHVVDGLG
ARVNGVPREDGFEITVASEIMAVLCLSNDIEDLKENLANIIIGYTYDNQPVTARELNAQG
AMTALLKDAIKPNLVQTLENNPALIHGGPFANIAHGCNSVIATNTARKLADYVVTEGGFG
ADLGAEKFIDIKCRKSGIRPSAVVVVATVRALKMHGGVPKDQLGIENIAALTDGLPNLLK
HIENTTTVFGLPTVVAINKFPTDTDAELELVKEECQKRNVNVVLSDVWAHGGAGGEELAQ
EVVRLADQENHFSFAYPDEWPIKEKISAIVEKIYGGNAVRYEPIAEREITKLEKLGFGHL
PICMAKTQYSFSDDQTKLGRPTDFTITVSNIKISAGAGFIVAYTGTVMTMPGLPKKAAYE
KIDVDSDGKIVGLF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaaaacagatattgagattgcacaagaagcaattatgctaccagtcactaaagta
gcagaaaaactaggtttgaatgaagagcaatttgaattatacggaaaatataaagcaaaa
atcgaagttgataaaatcaaaacgaacaaagaaggaaaagtgattctggttacggcaatc
acgcctacacctgctggcgaaggaaaaacaaccacagttgtcggcttaggtgatgcgttg
aatcgaattggcaaagatgcaatcatcgctttaagagaaccttctttaggccctgttttc
ggtataaaaggcggagccgcaggcgggggttatgcgcaagttgtcccaatggaagatatt
aaccttcattttacaggggattttcatgcgattggtgcagcgaataacttgttagctgca
attattgataatcatatttttcaagggaatgagttagggattgataatcgccgtatcact
tggaaacgagcggtagatatgaatgatcgccaattaagacacgttgtcgatggtttaggg
gcccgagtcaatggtgttcctagagaagatggatttgaaatcactgttgcctcagaaata
atggctgttttgtgtctgtccaatgatatcgaagatttaaaagagaatctagccaatatc
attattggatacacatacgataatcagcctgttactgccagagaactgaatgcacaaggg
gcaatgacagctttattaaaagatgcaatcaagcctaatctggtgcagacattggaaaat
aaccctgctttgatccatggtggaccgtttgcaaatattgcccatggctgtaacagtgtg
atcgcaacgaatacagctagaaaattagcagattatgtcgtgactgaaggaggctttggt
gctgatttaggtgcggaaaaattcatcgatatcaaatgccgcaaatccggcattcgtcct
tctgctgtcgttgttgtagcaactgttcgtgcactaaaaatgcatggtggtgtacccaaa
gatcaacttggtatcgaaaatattgcagcattaacagacggattaccgaatcttttaaaa
catatcgaaaatacaacgacagtattcggtttaccaacagttgtggcgatcaataaattt
cctacagatacagatgcggagcttgagcttgtgaaggaagaatgtcaaaaacgcaatgtg
aatgtagttctttcagatgtctgggcacatggtggtgctggtggtgaagagctagcgcaa
gaagtggttcgtttagcagatcaggaaaatcatttttcatttgcctatccagacgaatgg
ccgatcaaagaaaaaatcagtgcgatcgtggagaaaatttatggtggaaatgctgttcgc
tatgaaccaatcgctgaaagagaaatcactaaactggaaaaacttgggttcggtcattta
ccgatttgtatggctaaaacgcaatattcattttcagatgatcaaacgaaattaggcaga
ccaactgattttacaataacagttagtaatatcaagatctcggctggtgcaggatttatt
gttgcttatacaggaactgtgatgacaatgcctggcttaccgaaaaaagcagcatacgag
aaaatcgatgttgattctgatggaaagattgttggtttattctag

DBGET integrated database retrieval system