KEGG   Echinicola strongylocentroti: DN752_11695Help
Entry
DN752_11695       CDS       T05506                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
est  Echinicola strongylocentroti
Pathway
est00350  Tyrosine metabolism
est00360  Phenylalanine metabolism
est00380  Tryptophan metabolism
est01100  Metabolic pathways
est01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:est00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DN752_11695
   00360 Phenylalanine metabolism
    DN752_11695
   00380 Tryptophan metabolism
    DN752_11695
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:est04147]
    DN752_11695
Enzymes [BR:est01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     DN752_11695
    4.1.1.105  L-tryptophan decarboxylase
     DN752_11695
Exosome [BR:est04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DN752_11695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC SepSecS Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AWW30732
UniProt: A0A2Z4IHY1
Position
complement(3020806..3022236)
Genome map
AA seq 476 aa AA seqDB search
MDNRDFRKHAHQLVDWMADYLEQKENYPVTPDIKPGEIYDKFPDKAPEDPATFDEIFADF
EEVILPGMTHWQHPMFFGYFPANTSAPSIMAEMLMSTLGAQCMSWLTSPAATELEERVVN
WLRDAKGLNSTWKGVIQDTASTATLCAILAARERASKFSVNEKGFCGQEKFRVYSSEHAH
SSVDKAMRIAGLGHQNLVKIPVDTSFAMIPEALESAIEADIQNGFTPLCVVSALGTTSSA
AIDPIGEIGKLAARFEMWHHIDAAYAGTALLLPEFRWMIEGHELADSYVFNPHKWMFTNF
DCSVLFVKNADDLVHTFSMTTEYLKTDQDEHVHNYRDWGIQLGRRFRALKLWWVIRSYGL
AGIREKLRGHIRHTKLAKKWIENEENVIVETASVLNVICFRFVEKSLSTPQQNAFNKAWM
DGVNASGKVFFTSTILNGAFVIRWVIGQTDVKREHVLMACDCLKSELETVKRVFTI
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggataaccgcgactttagaaagcatgcccatcagttggtcgactggatggctgattat
ttggagcaaaaagagaactatcccgtaactcctgatattaagccgggagagatttatgat
aagtttcccgacaaggcaccggaagatcccgcaacgtttgatgagatttttgcggatttt
gaagaagtgatactgcctggaatgacgcactggcaacatccgatgtttttcggttacttt
ccagcaaatacttctgcgccatctatcatggccgagatgctcatgtccacattgggtgcc
cagtgtatgtcctggctaacgtctccggctgctaccgaactggaagaaagagtggtcaat
tggctgcgagatgccaaaggactgaattccacgtggaaaggtgtcatccaggatactgct
tctacggctacgctatgtgctattttggccgctagggaacgagcaagcaaattttctgtt
aatgaaaagggcttctgtggccaggagaaattcagggtgtatagctctgagcacgcccat
tcgtcggtggataaggcaatgcgaatagcgggactggggcatcaaaatctggtaaaaatc
cccgtggacaccagtttcgccatgatcccggaggctttggaaagcgctatagaagcggat
atacaaaatggatttacaccattgtgcgtagtttcggctttgggaacgaccagttcggcg
gccattgaccctattggagagatcggaaaattagctgctcgatttgaaatgtggcatcat
atcgacgcagcctatgccggcactgccctcctacttccggaatttcgctggatgattgag
ggacatgagttggccgacagctatgtcttcaatccgcacaaatggatgtttacaaacttt
gattgctcggtgctttttgtaaaaaatgctgatgatcttgtccacacattttccatgacc
accgaataccttaaaactgatcaagatgagcatgtgcataactaccgtgattgggggatt
cagttgggacgtaggtttcgcgctttgaagctttggtgggtgatcaggtcctatggtttg
gcaggaattcgtgaaaagctcagagggcatattagacatacgaaattggcaaaaaaatgg
attgaaaatgaagaaaatgtaatagtggaaacagctagtgttttgaatgtcatttgtttc
cgatttgtggaaaagtcactatccacaccccaacaaaatgcctttaacaaggcttggatg
gatggagtaaatgccagtggaaaagtctttttcacttcgactatattaaacggagcattc
gtgattcgatgggtcatcggccagacggacgtaaaaagggagcatgtcctaatggcttgc
gattgcctaaaatccgaactggaaactgtgaaaagggtgtttaccatttaa

DBGET integrated database retrieval system